PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013609698.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 202aa MW: 23507.4 Da PI: 10.232 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90 | 1.2e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien++ rqvtfskRr+g++KKA+ELSvLCda+va iifs++g+ly++ s XP_013609698.1 9 KKIENTTSRQVTFSKRRKGLFKKAHELSVLCDAQVAAIIFSQKGRLYDFTS 59 68**********************************************975 PP | |||||||
2 | K-box | 64.5 | 3.9e-22 | 85 | 172 | 11 | 98 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 e+ + l++e+a + ++ie+L+ +R+l+G++L s+s+keLq++ +q++ksl +R +K +l+ ++ie+l+ ke+el++e +L +++ XP_013609698.1 85 EQYVQGLKKEMATMVEKIEMLEVHNRKLMGQNLASCSVKELQEIATQIKKSLHIVRLRKAKLYGDEIEKLKAKERELKDERVRLCERV 172 6778999***************999*******************************************************99987765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.202 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.5E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.71E-38 | 3 | 73 | No hit | No description |
PRINTS | PR00404 | 9.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.45E-31 | 3 | 87 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.583 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.6E-21 | 88 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0002098 | Biological Process | tRNA wobble uridine modification | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033588 | Cellular Component | Elongator holoenzyme complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MVRGKIQIKK IENTTSRQVT FSKRRKGLFK KAHELSVLCD AQVAAIIFSQ KGRLYDFTSS 60 DIQKTIKRYA EYKREYFVAE SHPMEQYVQG LKKEMATMVE KIEMLEVHNR KLMGQNLASC 120 SVKELQEIAT QIKKSLHIVR LRKAKLYGDE IEKLKAKERE LKDERVRLCE RVGERPLGTP 180 SSSEEKEDVE TDLVIGFPKS RR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 5e-20 | 1 | 93 | 1 | 90 | MEF2C |
5f28_B | 5e-20 | 1 | 93 | 1 | 90 | MEF2C |
5f28_C | 5e-20 | 1 | 93 | 1 | 90 | MEF2C |
5f28_D | 5e-20 | 1 | 93 | 1 | 90 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013609698.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013609697.1 | 1e-146 | PREDICTED: MADS-box protein SOC1-like isoform X1 | ||||
Refseq | XP_013609698.1 | 1e-146 | PREDICTED: MADS-box protein SOC1-like isoform X1 | ||||
Refseq | XP_013672589.1 | 1e-146 | MADS-box protein AGL72-like isoform X1 | ||||
Refseq | XP_013719906.1 | 1e-146 | MADS-box protein AGL72-like isoform X1 | ||||
Swissprot | Q9FLH5 | 1e-119 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | M4EHL7 | 1e-138 | M4EHL7_BRARP; Uncharacterized protein | ||||
STRING | Bra028282.1-P | 1e-139 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 1e-124 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|