PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013609176.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 217aa MW: 25056.7 Da PI: 9.786 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 95.7 | 2.1e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva++ifs++gklye+ss XP_013609176.1 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRGKLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 74.3 | 3.4e-25 | 82 | 172 | 9 | 99 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + e ++++ + e L ++ie+L+ ++R++lGe+L+ s++eLqqLe+qLe+sl+kiR+kK++ll+e++++l++ke++l enk+L +k+e XP_013609176.1 82 KREDNTQQAKGETYGLARKIEQLEISKRKFLGEGLDASSIEELQQLENQLERSLTKIRAKKYQLLREELDKLKEKERNLTAENKMLLEKYE 172 67889999*******************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 4.9E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.903 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.3E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.04E-40 | 3 | 79 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.28E-32 | 3 | 74 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.7E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.3E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.3E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.2E-24 | 83 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.87 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010082 | Biological Process | regulation of root meristem growth | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:2000012 | Biological Process | regulation of auxin polar transport | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALVIFSP RGKLYEFSSS 60 SSITKTVERY QKRIHDLGSS HKREDNTQQA KGETYGLARK IEQLEISKRK FLGEGLDASS 120 IEELQQLENQ LERSLTKIRA KKYQLLREEL DKLKEKERNL TAENKMLLEK YEMGRGGIIP 180 KTTSEDLDTE ESEMEVVTDL LIGPPPIRHY KKFHPPN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-16 | 1 | 60 | 1 | 60 | MEF2C |
5f28_B | 2e-16 | 1 | 60 | 1 | 60 | MEF2C |
5f28_C | 2e-16 | 1 | 60 | 1 | 60 | MEF2C |
5f28_D | 2e-16 | 1 | 60 | 1 | 60 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During floral transition, expressed very early at the flanks of the inflorescence meristem in the anlagens upon the transition to flowering Subsequently, expression levels increase in the first and second stages of the floral meristem and at stage 3, expression is restricted to the L1 and L2 layers. Later on, expressed in the gynoecium and stamen primordia at stage 6. {ECO:0000269|PubMed:25636918}. | |||||
Uniprot | TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). Expressed in lateral root cap, root epidermis, root endodermis, columella of the root meristematic region, the vascular cylinder in differentiated zones of the primary root and in emerged lateral root primordia (PubMed:24121311). Expressed in pollen (PubMed:12949148). {ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:24121311, ECO:0000269|PubMed:7549482}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013609176.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin. {ECO:0000269|PubMed:24121311}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013609175.1 | 1e-157 | PREDICTED: agamous-like MADS-box protein AGL14 | ||||
Refseq | XP_013609176.1 | 1e-157 | PREDICTED: agamous-like MADS-box protein AGL14 | ||||
Refseq | XP_013609177.1 | 1e-157 | PREDICTED: agamous-like MADS-box protein AGL14 | ||||
Refseq | XP_013609178.1 | 1e-157 | PREDICTED: agamous-like MADS-box protein AGL14 | ||||
Refseq | XP_013652201.1 | 1e-157 | agamous-like MADS-box protein AGL14 | ||||
Refseq | XP_013652202.1 | 1e-157 | agamous-like MADS-box protein AGL14 | ||||
Refseq | XP_013652203.1 | 1e-157 | agamous-like MADS-box protein AGL14 | ||||
Refseq | XP_013652204.1 | 1e-157 | agamous-like MADS-box protein AGL14 | ||||
Swissprot | Q38838 | 1e-114 | AGL14_ARATH; Agamous-like MADS-box protein AGL14 | ||||
TrEMBL | A0A078FK04 | 1e-156 | A0A078FK04_BRANA; BnaC09g23670D protein | ||||
TrEMBL | A0A0D3E9E2 | 1e-156 | A0A0D3E9E2_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6EA19 | 1e-156 | A0A3P6EA19_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g093920.1 | 1e-157 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11880.1 | 2e-97 | AGAMOUS-like 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|