PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013608170.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 126aa MW: 14244 Da PI: 11.1883 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 79.2 | 4.8e-25 | 37 | 90 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +pr Wtp+LH+rF++a e+ G+++AtPk+i e+m+v+gLt+ v+SHLQkYR XP_013608170.1 37 RPRNIWTPQLHQRFLDAFEHH-GINHATPKRITEFMNVDGLTRGSVASHLQKYRY 90 5899*****************.9*******************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.405 | 32 | 93 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.13E-20 | 34 | 94 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.6E-25 | 36 | 95 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.7E-22 | 38 | 90 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 6.7E-8 | 41 | 89 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MPSQLQLPSS QANSSAEFAE NSADRGSGDE PARTLRRPRN IWTPQLHQRF LDAFEHHGIN 60 HATPKRITEF MNVDGLTRGS VASHLQKYRY QLKRIERREP FASFLVGKIK PSPSPSPSPS 120 PLQSRL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5lxu_A | 7e-22 | 37 | 93 | 1 | 57 | Transcription factor LUX |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, stems, petioles, filaments, stigma, pedicels, sepals, anthers, petals, and siliques. {ECO:0000269|PubMed:20331973}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013608170.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189431 | 9e-97 | AC189431.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068B07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013608170.1 | 3e-88 | PREDICTED: transcription factor LUX-like | ||||
Swissprot | O22210 | 3e-26 | MYBC1_ARATH; Transcription factor MYBC1 | ||||
TrEMBL | A0A0D3EB03 | 4e-86 | A0A0D3EB03_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6E9S6 | 4e-86 | A0A3P6E9S6_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g117350.1 | 6e-87 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15903 | 7 | 12 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G10760.1 | 2e-31 | G2-like family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|