PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013607053.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 335aa    MW: 37762.1 Da    PI: 7.0966
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013607053.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.91.5e-061052440
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    ++C+++ +   + +C+ ++ +lC +C  + H        H++v
  XP_013607053.1 10 QTCDTCRSAACTVYCRADSAYLCTNCDAQVHAAnrlasrHERV 52
                    79******99*********************556788888776 PP

2zf-B_box35.71.7e-115297342
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                     r+C+ +e+ ++ +fC+ +   lC  C +++H+       H++vp+
  XP_013607053.1 52 VRVCQSCERAPAAFFCKADAASLCTACDSQIHSAnplarrHQRVPI 97
                    689*****************************66899999**9997 PP

3CCT63.18.3e-22265309145
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                     R+a+++RY+eK+k+RkFeK+irY+sRK++Ae+RpR+KGrF+k++e
  XP_013607053.1 265 RKARVMRYREKKKKRKFEKRIRYASRKEYAEKRPRIKGRFAKRNE 309
                     9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.836754IPR000315B-box-type zinc finger
SMARTSM003363.4E-9754IPR000315B-box-type zinc finger
CDDcd000219.67E-81254No hitNo description
PROSITE profilePS5011912.2875097IPR000315B-box-type zinc finger
PfamPF006434.1E-95297IPR000315B-box-type zinc finger
CDDcd000211.73E-95397No hitNo description
SMARTSM003361.9E-125597IPR000315B-box-type zinc finger
PfamPF062033.8E-16265307IPR010402CCT domain
PROSITE profilePS5101716.737265307IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MLKQESNWAQ TCDTCRSAAC TVYCRADSAY LCTNCDAQVH AANRLASRHE RVRVCQSCER  60
APAAFFCKAD AASLCTACDS QIHSANPLAR RHQRVPILPI SGSMVTNHSS ETTETEDIVV  120
VGQEEEDEAE AASWLLPSSL KNSGDNNNNN NNNNSENRFS VGDEYVDLVD YNKYQQDYNV  180
PQRSYVADGV VPLQVGVLKS HMHHEEHNFQ FGFTNVSSEA SPIHMVSLVP ESTLSETTVS  240
HPRSPKVATE ELHDAPVQML SPVERKARVM RYREKKKKRK FEKRIRYASR KEYAEKRPRI  300
KGRFAKRNEV DAEEADKAFS SMVMFDTGYG IVPSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1274279KKKKRK
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout development.
UniprotTISSUE SPECIFICITY: Highly expressed in leaves and at lower levels in stems, flowers and siliques. Not detected in roots.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013607053.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM2957780.0AM295778.1 Brassica oleracea var. alboglabra 1col1-O9 gene for CONSTANS-like1 protein and 1co-O9 gene for CONSTANS protein, exons 1-2, clone JBo061D17.
GenBankAM2957790.0AM295779.1 Brassica oleracea var. alboglabra 1col1-O2 gene for CONSTANS-like1 protein, clone JBo052K23.
GenBankAM2957810.0AM295781.1 Brassica oleracea var. alboglabra 1col1-O3 gene for CONSTANS-like1 protein, clone JBo045L20.
GenBankAM2957830.0AM295783.1 Brassica oleracea var. italica 1col1-GD gene for CONSTANS-like1 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607053.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 1
SwissprotO500551e-150COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLA0A0D3EF720.0A0A0D3EF72_BRAOL; Uncharacterized protein
TrEMBLA0A3P6ERB20.0A0A3P6ERB2_BRAOL; Uncharacterized protein
TrEMBLQ05GM50.0Q05GM5_BRAOT; CONSTANS-like1 protein
TrEMBLQ05GM70.0Q05GM7_BRAOA; CONSTANS-like1 protein
STRINGBo9g163720.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-125CONSTANS-like 1
Publications ? help Back to Top
  1. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]
  2. An C, et al.
    Mediator subunit MED25 links the jasmonate receptor to transcriptionally active chromatin.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(42): p. E8930-E8939
    [PMID:28973940]
  3. Ordoñez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]