PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013605338.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 249aa MW: 28278.9 Da PI: 9.6644 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.9 | 4.1e-31 | 24 | 74 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+s XP_013605338.1 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAS 74 79***********************************************86 PP | |||||||
2 | K-box | 112.4 | 4.7e-37 | 96 | 187 | 8 | 99 |
K-box 8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++ea+++++qqe++kL+++i+ +q+++Rh++Ge+L+sL++keL++Le +Lek+++++RskK+ell+++ie++qk++ elq++n++Lr+k+e XP_013605338.1 96 TVTEANTQYYQQEASKLRRQIRDIQNSNRHIVGESLGSLNFKELKNLEGRLEKGISRVRSKKSELLVAEIEYMQKRKMELQHDNMYLRAKIE 187 4899**************************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.641 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.1E-40 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.05E-44 | 17 | 90 | No hit | No description |
SuperFamily | SSF55455 | 4.45E-33 | 17 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.2E-33 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.3E-26 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.2E-33 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.2E-33 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 7.7E-27 | 100 | 186 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.833 | 102 | 192 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MDESGSSHDA ESSKKIGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 VIFSTRGRLY EYASNSVKGT IERYKKACSD AVNPPTVTEA NTQYYQQEAS KLRRQIRDIQ 120 NSNRHIVGES LGSLNFKELK NLEGRLEKGI SRVRSKKSEL LVAEIEYMQK RKMELQHDNM 180 YLRAKIEQGA RLNPEQHGSG VIQGTAVYDS GLSSSPDQSQ HYNRNYIPVN LLEPNQQFSG 240 QDQPPLQLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 1e-20 | 16 | 84 | 1 | 69 | MEF2C |
5f28_B | 1e-20 | 16 | 84 | 1 | 69 | MEF2C |
5f28_C | 1e-20 | 16 | 84 | 1 | 69 | MEF2C |
5f28_D | 1e-20 | 16 | 84 | 1 | 69 | MEF2C |
6c9l_A | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013605338.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY036062 | 0.0 | AY036062.1 Brassica napus SHATTERPROOF1 (BnSHP1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013605337.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL1 isoform X1 | ||||
Refseq | XP_013605338.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL1 isoform X1 | ||||
Refseq | XP_013605339.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL1 isoform X1 | ||||
Refseq | XP_013663681.1 | 0.0 | agamous-like MADS-box protein AGL1 | ||||
Swissprot | P29381 | 1e-169 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
TrEMBL | A0A3N6TS57 | 0.0 | A0A3N6TS57_BRACR; Uncharacterized protein | ||||
STRING | Bra007419.1-P | 1e-175 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.1 | 1e-159 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|