PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013604928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 561aa    MW: 62937.8 Da    PI: 6.3876
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013604928.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.23.2e-23127227198
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv++++L +gD +vF   + +
  XP_013604928.1 127 FVKILTASDTSTHGGFSVLRKHATEClpaldmtQ--ATPTQELVTRDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDAFVFL--RGE 217
                     89****************************9543..445569************************************************..348 PP

                     EE..EEEEE- CS
              B3  89 efelvvkvfr 98 
                     ++ l+v+v+r
  XP_013604928.1 218 NGDLRVGVRR 227
                     8889***998 PP

2Auxin_resp95.58.1e-32253332183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t++ F v+Y+Pr   s+F+v v+k+++a+k+ +s+G+Rf+m+fe+e+s+er ++Gt+vgv dl++ +Wp S WrsL+
  XP_013604928.1 253 ASHAVNTQTLFLVLYKPRI--SQFIVGVNKYMEAMKHGFSLGTRFRMRFEGEESPERIFTGTIVGVGDLSS-QWPASTWRSLQ 332
                     789***************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.23E-40112256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-38120242IPR015300DNA-binding pseudobarrel domain
CDDcd100179.21E-20125227No hitNo description
PROSITE profilePS5086312.083127229IPR003340B3 DNA binding domain
PfamPF023622.8E-21127227IPR003340B3 DNA binding domain
SMARTSM010191.3E-20127229IPR003340B3 DNA binding domain
PfamPF065072.2E-29253332IPR010525Auxin response factor
PfamPF023099.7E-8452493IPR033389AUX/IAA domain
SuperFamilySSF542773.24E-12454533No hitNo description
PROSITE profilePS5174525.792457549IPR000270PB1 domain
PfamPF023095.3E-6497545IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MGKVDGDDSR SSFPSCYQDQ LYTELWKACA GPLVEVPLVG ERVFYFPQGH MEQLVASTNQ  60
GIESEKIPDF KLPPKILCQV LSVMLKAEHE TDEVYAQITL KPEEDQSEPT SFDPPIVEPA  120
KQMFHSFVKI LTASDTSTHG GFSVLRKHAT ECLPALDMTQ ATPTQELVTR DLHGFEWRFK  180
HIFRGQPRRH LLTTGWSTFV SSKRLVAGDA FVFLRGENGD LRVGVRRLAR HQNTMPASVI  240
SSQSMHLGVL ATASHAVNTQ TLFLVLYKPR ISQFIVGVNK YMEAMKHGFS LGTRFRMRFE  300
GEESPERIFT GTIVGVGDLS SQWPASTWRS LQVQWDEPTT VQRPDKVSPW EIEPFLPSSP  360
VSTPAQQSQP KSKRSKPIES SSLSPGQASF LGVQAEPPPP PPPASSCYRL FGFDLTSNPP  420
APIPPDKQPM DACEAAKCQD PITPSSVNEP KKQQTSRTRT KVQMQGIAVG RAVDLTLLKS  480
YDELIKELEE MFEIQGQLLP RDKWIVVFTD DEGDMMLAGD DPWNEFCKMA KKIFIYSSDE  540
VKKMTRRMKS YSSLENEVSM D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1631935517355Auxin response factor 1
4ldw_A1e-1631935517355Auxin response factor 1
4ldw_B1e-1631935517355Auxin response factor 1
4ldx_A1e-1631935517355Auxin response factor 1
4ldx_B1e-1631935517355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013604928.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0006080.0KT000608.1 Brassica napus note R1 line auxin response factor 18 (ARF18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013604928.10.0PREDICTED: auxin response factor 18
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0D3DUY10.0A0A0D3DUY1_BRAOL; Auxin response factor
STRINGBo8g097320.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]