PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013603082.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 279aa MW: 32183.4 Da PI: 4.6268 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.1 | 1.5e-16 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+++Ed++l+ ++++G ++W++ ++ g+ R++k+c++rw +yl XP_013603082.1 16 RGPWSQDEDLKLISFIHKYGHENWRSLPKQAGLLRCGKSCRLRWINYL 63 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.6 | 1.1e-16 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T eE+e ++++++ +G++ W++Ia++++ gRt++++k+ w+++l XP_013603082.1 69 RGNFTLEEEETIIKLHQSFGNK-WSKIASKLP-GRTDNEIKNVWHTHL 114 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.2E-24 | 7 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.341 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.6E-29 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-13 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-15 | 16 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.11E-9 | 18 | 63 | No hit | No description |
PROSITE profile | PS51294 | 25.529 | 64 | 118 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.5E-27 | 67 | 118 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.0E-14 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.7E-15 | 69 | 114 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.60E-10 | 71 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009809 | Biological Process | lignin biosynthetic process | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 279 aa Download sequence Send to blast |
MGKGRAPCCD KTKVKRGPWS QDEDLKLISF IHKYGHENWR SLPKQAGLLR CGKSCRLRWI 60 NYLRPDLKRG NFTLEEEETI IKLHQSFGNK WSKIASKLPG RTDNEIKNVW HTHLKKRLNS 120 YINHNASDEA ASKGSLNKEE TSQESSPNAS RSFGGSNIVS KEEEDDVQIG ETFEYFQDYS 180 ELAGLLQEVD KPELLEIPFD IDPDVWNFLE GFQQPENSLT PKDHQESEED EVDKWFKNLE 240 SELGLEEDDS QQQQEQNNEA KEDSPSPSLL ESYEVLINH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-25 | 16 | 120 | 7 | 110 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In nonelongating internodes, highly expressed in interfascicular fibers and xylem cells but not in parenchymatous pith cells. In elongating internodes, predominantly expressed in protoxylem vessels. {ECO:0000269|PubMed:19122102}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves (PubMed:9839469). Specifically expressed in fibers and vessels undergoing secondary wall thickening, especially in inflorescence stems (PubMed:19122102). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00144 | DAP | Transfer from AT1G16490 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013603082.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM975654 | 0.0 | KM975654.1 Brassica napus MYB transcription factor 58.1 (MYB58.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013603082.1 | 0.0 | PREDICTED: myb-related protein Myb4 | ||||
Refseq | XP_013710348.1 | 0.0 | transcription factor MYB58 | ||||
Swissprot | Q9SA47 | 1e-152 | MYB58_ARATH; Transcription factor MYB58 | ||||
TrEMBL | A0A078D0J5 | 0.0 | A0A078D0J5_BRANA; MYB transcription factor 58.1 | ||||
TrEMBL | A0A0D3DWZ9 | 0.0 | A0A0D3DWZ9_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6GFV0 | 0.0 | A0A3P6GFV0_BRAOL; Uncharacterized protein | ||||
STRING | Bo8g105490.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16490.1 | 1e-144 | myb domain protein 58 |
Publications ? help Back to Top | |||
---|---|---|---|
|