PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013602373.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 195aa MW: 21716.5 Da PI: 8.6746 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 183.4 | 1.8e-57 | 34 | 131 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdrflPian+srimk+ lPan+ki+kdaket+qecvsefisfvtseasdkcqrekrktingddllwa++tlGfe+yveplk yl++yre+eg XP_013602373.1 34 VREQDRFLPIANISRIMKRGLPANGKIAKDAKETMQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKFYLTRYREMEG 128 69********************************************************************************************* PP NF-YB 96 ekk 98 ++k XP_013602373.1 129 DNK 131 975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.1E-54 | 30 | 139 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.88E-40 | 37 | 137 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.7E-28 | 40 | 104 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.4E-21 | 68 | 86 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 71 | 87 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.4E-21 | 87 | 105 | No hit | No description |
PRINTS | PR00615 | 5.4E-21 | 106 | 124 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MADSQAKSSG MSPGVGGGGS HESGGDQSPR SMNVREQDRF LPIANISRIM KRGLPANGKI 60 AKDAKETMQE CVSEFISFVT SEASDKCQRE KRKTINGDDL LWAMTTLGFE EYVEPLKFYL 120 TRYREMEGDN KGSGKGGESS VSAAGWSARL FLTRSLWKLS RFAYDGSNAE RRVVVEQYSS 180 QSTEIHLFMF LFPRI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-47 | 34 | 125 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-47 | 34 | 125 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013602373.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC787672 | 1e-134 | KC787672.1 Brassica napus transcription factor subunit NF-YB10 (NF-YB1) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013602373.1 | 1e-144 | PREDICTED: nuclear transcription factor Y subunit B-10 isoform X1 | ||||
Swissprot | Q8VYK4 | 4e-82 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0D3DSR1 | 4e-98 | A0A0D3DSR1_BRAOL; Uncharacterized protein | ||||
STRING | Bo8g082690.1 | 6e-99 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 5e-66 | nuclear factor Y, subunit B10 |
Publications ? help Back to Top | |||
---|---|---|---|
|