PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013602028.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 267aa MW: 29225.9 Da PI: 9.7407 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 223.6 | 1.6e-69 | 90 | 228 | 1 | 139 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 s+yk+kaal+v++++p+f++ldsg++kl+++G+lll++a+a+++r+ydW+kkq+f+ls+ e+++lv+l+++esceffhdp +++s+eGkvrk+lk XP_013602028.1 90 SIYKGKAALTVEPRAPEFVSLDSGAFKLSKDGFLLLQFAPAAGVRQYDWSKKQVFSLSVSEIGTLVSLGPRESCEFFHDPNKGKSDEGKVRKVLK 184 7********************************************************************************************** PP Whirly 96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139 vePlpdGsG+f+nlsv+n+l++++e++++Pv++aefavl s+++ XP_013602028.1 185 VEPLPDGSGHFFNLSVQNKLLNVDENIYIPVTRAEFAVLTSAFN 228 ****************************************9996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 6.9E-80 | 80 | 251 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 1.8E-79 | 84 | 267 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 4.0E-62 | 91 | 225 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0032211 | Biological Process | negative regulation of telomere maintenance via telomerase | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
GO:0009508 | Cellular Component | plastid chromosome | ||||
GO:0009570 | Cellular Component | chloroplast stroma | ||||
GO:0003697 | Molecular Function | single-stranded DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003723 | Molecular Function | RNA binding | ||||
GO:0042162 | Molecular Function | telomeric DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 267 aa Download sequence Send to blast |
MSQLLSSPLM AASYSPFTSH RFLSSSSSVL VAGGGLAVKR HGLASKPVRT VNLSVKSRQT 60 DYFEKQRFGD SSSSSQNGEG GPARFYVGHS IYKGKAALTV EPRAPEFVSL DSGAFKLSKD 120 GFLLLQFAPA AGVRQYDWSK KQVFSLSVSE IGTLVSLGPR ESCEFFHDPN KGKSDEGKVR 180 KVLKVEPLPD GSGHFFNLSV QNKLLNVDEN IYIPVTRAEF AVLTSAFNFV LPYLIGWHAF 240 ANSIKPEEAN RTSNASPNYG GDYEWNR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4koo_A | 1e-114 | 78 | 245 | 2 | 169 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_B | 1e-114 | 78 | 245 | 2 | 169 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_C | 1e-114 | 78 | 245 | 2 | 169 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_D | 1e-114 | 78 | 245 | 2 | 169 | Single-stranded DNA-binding protein WHY1, chloroplastic |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bol.4619 | 0.0 | leaf |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In nucleus, modulates telomere length homeostasis by inhibiting the action of the telomerase at the extreme termini of chromosomes. Is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Is required for full salicylic acid-dependent plant disease resistance responses. Can bind double-stranded DNA in vivo. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:17217467, ECO:0000269|PubMed:19666500, ECO:0000269|PubMed:19669906, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:21911368}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013602028.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA) and infection by H.parasitica. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:19669906}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF332452 | 0.0 | AF332452.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds. | |||
GenBank | AF370156 | 0.0 | AF370156.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds. | |||
GenBank | AY059097 | 0.0 | AY059097.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013602028.1 | 0.0 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic | ||||
Refseq | XP_013657384.1 | 0.0 | single-stranded DNA-binding protein WHY1, chloroplastic | ||||
Swissprot | Q9M9S3 | 1e-162 | WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | A0A0D3DPN9 | 0.0 | A0A0D3DPN9_BRAOL; Uncharacterized protein | ||||
STRING | Bo8g066030.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5023 | 27 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14410.1 | 1e-156 | ssDNA-binding transcriptional regulator |