PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013597086.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 212aa MW: 24704.6 Da PI: 9.9238 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.9 | 1.8e-16 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +l d+v +G+g+W++I r+ g++R++k+c++rw +yl XP_013597086.1 17 KGLWTVEEDSILRDYVLTHGKGQWNRIVRKTGLKRCGKSCRLRWINYL 64 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 60 | 5.3e-19 | 70 | 115 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w ++l XP_013597086.1 70 KGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNHWSTHL 115 79********************.*********.***********9886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.402 | 12 | 64 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.46E-30 | 15 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.8E-13 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.1E-14 | 17 | 64 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-23 | 18 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.00E-9 | 20 | 64 | No hit | No description |
PROSITE profile | PS51294 | 27.183 | 65 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 5.2E-18 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.3E-18 | 70 | 115 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.69E-12 | 72 | 115 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.3E-26 | 72 | 118 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0032880 | Biological Process | regulation of protein localization | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:2000039 | Biological Process | regulation of trichome morphogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
MRTRRRTEEE NHQEYKKGLW TVEEDSILRD YVLTHGKGQW NRIVRKTGLK RCGKSCRLRW 60 INYLSPNVNK GNFTEQEEDL IIRLHKLLGN RWSLIAKRVP GRTDNQVKNH WSTHLSKKNR 120 RGLSSAVKTT GEENYPPSLL ITAATASGHH QQDKICDKSF EGLVSASNGN KQKADLTHTN 180 DLSLYFKERN NFDSSNTFWF NDDDDFEMNH SL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-26 | 17 | 118 | 7 | 107 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves primordia. Becomes more prominent in developing trichome cells but disappears progressively when trichomes begin to initiate branches. {ECO:0000269|PubMed:15728674}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves, stems and flowers (PubMed:11437443). Expressed in trichome cells and in leaf primordia (PubMed:9625690). {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:9625690}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269|PubMed:11063707, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15728674, ECO:0000269|PubMed:9625690}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013597086.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by gibberellins (PubMed:9625690). May be regulated by GEBP and GEBP-like proteins (PubMed:12535344). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:9625690}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF188209 | 0.0 | KF188209.1 Brassica villosa BVGL1 (BVGL1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013597086.1 | 1e-158 | PREDICTED: trichome differentiation protein GL1 | ||||
Swissprot | P27900 | 4e-97 | GL1_ARATH; Trichome differentiation protein GL1 | ||||
TrEMBL | A0A0D3DBZ2 | 1e-157 | A0A0D3DBZ2_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6EQY4 | 1e-157 | A0A3P6EQY4_BRAOL; Uncharacterized protein | ||||
STRING | Bo7g090950.1 | 1e-157 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27920.1 | 1e-99 | myb domain protein 0 |