PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013596747.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 219aa MW: 25253.1 Da PI: 7.9588 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89 | 2.6e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRr+g+lKKA+ELSvLCda+va i+fs++g+ly+++s XP_013596747.1 9 KRIENVTSRQVTFSKRRKGLLKKAHELSVLCDAQVAAIVFSQKGRLYDFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 55.2 | 3.1e-19 | 84 | 177 | 10 | 100 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk...ekelqeenkaLrkklee 100 +++ ++ ++e+ak ++ie Lq R+l+G+dL+s+s++eL+++ +Leksl+ +Rs+K +l + ie+l+ eke+ +e+ +Lr+++ee XP_013596747.1 84 KQQFVQEVKNEMAKTLDQIELLQLHCRKLMGQDLDSCSVEELKEITIKLEKSLTIVRSRKAKLNEDTIEKLKAEisgEKEVLNETSSLRQMFEE 177 55667999***************999**********************************************754459999999999*999986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 7.8E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.497 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.57E-30 | 3 | 70 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.70E-40 | 3 | 69 | No hit | No description |
Pfam | PF00319 | 3.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.4E-18 | 85 | 175 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.895 | 88 | 181 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MVRGKIEIKR IENVTSRQVT FSKRRKGLLK KAHELSVLCD AQVAAIVFSQ KGRLYDFASS 60 DMQKMMERYD IHRSEYFGAE RLQKQQFVQE VKNEMAKTLD QIELLQLHCR KLMGQDLDSC 120 SVEELKEITI KLEKSLTIVR SRKAKLNEDT IEKLKAEISG EKEVLNETSS LRQMFEEPTL 180 WMHSRSLESE MSGPSCGYGN MNISDVKTEL SIGLPESRE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 6e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 6e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 6e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 6e-19 | 1 | 69 | 1 | 69 | MEF2C |
6c9l_A | 5e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013596747.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189309 | 2e-65 | AC189309.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034C07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013596747.1 | 1e-160 | PREDICTED: MADS-box transcription factor 23-like isoform X3 | ||||
Swissprot | Q9FLH5 | 6e-71 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | A0A397KZK0 | 1e-135 | A0A397KZK0_BRACM; Uncharacterized protein | ||||
STRING | Bo8g050720.1 | 1e-130 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.1 | 3e-67 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|