PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596447.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ZF-HD
Protein Properties Length: 100aa    MW: 10692.9 Da    PI: 8.0522
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596447.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.48.2e-343087360
     ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                    +vrY eC+kNhAa++Gg+avDGC+Efm+s+geeg++aal+CaACgCHR+FHRre e+e
  XP_013596447.1 30 GVRYGECQKNHAAAVGGYAVDGCREFMASNGEEGSVAALTCAACGCHRSFHRREIETE 87
                    79****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-35197IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.6E-293184IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.8E-283284IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.83383IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MRKRQVVLRR ASPEEPSRSS STASSLTVRG VRYGECQKNH AAAVGGYAVD GCREFMASNG  60
EEGSVAALTC AACGCHRSFH RREIETEVVC DCNSPPSTGN
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}.
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013596447.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9533301e-166EU953330.1 Zea mays clone 1399539 zinc finger homeodomain protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151830.11e-67PREDICTED: mini zinc finger protein 2
RefseqXP_009151831.11e-67PREDICTED: mini zinc finger protein 2
RefseqXP_009151833.11e-67PREDICTED: mini zinc finger protein 2
RefseqXP_013596447.11e-67PREDICTED: mini zinc finger protein 2
RefseqXP_013647450.11e-67mini zinc finger protein 2
RefseqXP_013705939.11e-67mini zinc finger protein 2
RefseqXP_022544006.11e-67mini zinc finger protein 2
RefseqXP_022562812.11e-67mini zinc finger protein 2
SwissprotQ9LJW53e-55MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A0D3DBF22e-66A0A0D3DBF2_BRAOL; Uncharacterized protein
TrEMBLA0A397Z9722e-66A0A397Z972_BRACM; Uncharacterized protein
TrEMBLB6SKR52e-66B6SKR5_MAIZE; Zinc finger homeodomain protein 1
TrEMBLM4E9A62e-66M4E9A6_BRARP; Uncharacterized protein
STRINGBra025362.1-P4e-67(Brassica rapa)
STRINGBo7g087070.14e-67(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.18e-51mini zinc finger 2
Publications ? help Back to Top
  1. Bollier N, et al.
    At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato.
    Plant Cell, 2018. 30(1): p. 83-100
    [PMID:29298836]