PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013596447.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 100aa MW: 10692.9 Da PI: 8.0522 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 107.4 | 8.2e-34 | 30 | 87 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa++Gg+avDGC+Efm+s+geeg++aal+CaACgCHR+FHRre e+e XP_013596447.1 30 GVRYGECQKNHAAAVGGYAVDGCREFMASNGEEGSVAALTCAACGCHRSFHRREIETE 87 79****************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 2.0E-35 | 1 | 97 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 5.6E-29 | 31 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 3.8E-28 | 32 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 24.8 | 33 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MRKRQVVLRR ASPEEPSRSS STASSLTVRG VRYGECQKNH AAAVGGYAVD GCREFMASNG 60 EEGSVAALTC AACGCHRSFH RREIETEVVC DCNSPPSTGN |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013596447.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU953330 | 1e-166 | EU953330.1 Zea mays clone 1399539 zinc finger homeodomain protein 1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009151830.1 | 1e-67 | PREDICTED: mini zinc finger protein 2 | ||||
Refseq | XP_009151831.1 | 1e-67 | PREDICTED: mini zinc finger protein 2 | ||||
Refseq | XP_009151833.1 | 1e-67 | PREDICTED: mini zinc finger protein 2 | ||||
Refseq | XP_013596447.1 | 1e-67 | PREDICTED: mini zinc finger protein 2 | ||||
Refseq | XP_013647450.1 | 1e-67 | mini zinc finger protein 2 | ||||
Refseq | XP_013705939.1 | 1e-67 | mini zinc finger protein 2 | ||||
Refseq | XP_022544006.1 | 1e-67 | mini zinc finger protein 2 | ||||
Refseq | XP_022562812.1 | 1e-67 | mini zinc finger protein 2 | ||||
Swissprot | Q9LJW5 | 3e-55 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A0D3DBF2 | 2e-66 | A0A0D3DBF2_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A397Z972 | 2e-66 | A0A397Z972_BRACM; Uncharacterized protein | ||||
TrEMBL | B6SKR5 | 2e-66 | B6SKR5_MAIZE; Zinc finger homeodomain protein 1 | ||||
TrEMBL | M4E9A6 | 2e-66 | M4E9A6_BRARP; Uncharacterized protein | ||||
STRING | Bra025362.1-P | 4e-67 | (Brassica rapa) | ||||
STRING | Bo7g087070.1 | 4e-67 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM944 | 28 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 8e-51 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|