PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013595232.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 631aa    MW: 71227.5 Da    PI: 6.564
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013595232.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B378.76.2e-25115216199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv a++L +gD++vF   + +
  XP_013595232.1 115 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTAKRLVAGDTFVFL--RGE 205
                     88****************************9643..445569************************************************..449 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     ++el+v+v+r+
  XP_013595232.1 206 NGELRVGVRRA 216
                     999******97 PP

2Auxin_resp107.21.9e-35241320183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a ha++t+s+F+v+Y+Pr+  s+F+++++k+++a+++k++vG Rfkm+fe+eds+err+sGtvvgv+d+++ +W++S+Wr+L+
  XP_013595232.1 241 ACHATQTRSMFTVYYKPRT--SQFIISLNKYLEAMSNKFAVGIRFKMRFEGEDSPERRFSGTVVGVKDCST-HWKDSNWRCLE 320
                     6899**************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.8E-43106230IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.24E-38108244IPR015300DNA-binding pseudobarrel domain
CDDcd100172.02E-21113215No hitNo description
PROSITE profilePS5086312.788115217IPR003340B3 DNA binding domain
SMARTSM010191.3E-24115217IPR003340B3 DNA binding domain
PfamPF023621.2E-22115216IPR003340B3 DNA binding domain
PfamPF065075.5E-32241319IPR010525Auxin response factor
PfamPF023094.3E-8496551IPR033389AUX/IAA domain
SuperFamilySSF542776.54E-12510591No hitNo description
PROSITE profilePS5174524.446515607IPR000270PB1 domain
PfamPF023093.7E-6561603IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MRTGEHMYGE LWKLCAGPVV DVPQAEERVF YFPQGHMEQL EASTQQDLNA VKPTKPLFDL  60
PPKILCRVMD VRLQAEKDTD EVYAQIMLMP EGTVDEPVSP DPSPPESQRP KVHSFSKVLT  120
ASDTSTHGGF SVLRKHATEC LPPLDMTQQT PTQELVAEDV HGYQWKFKHI FRGQPRRHLL  180
TTGWSTFVTA KRLVAGDTFV FLRGENGELR VGVRRANRQQ TNMPSSVISS HSMHLGVLAT  240
ACHATQTRSM FTVYYKPRTS QFIISLNKYL EAMSNKFAVG IRFKMRFEGE DSPERRFSGT  300
VVGVKDCSTH WKDSNWRCLE VHWDEPASIS RPDKVSPWEI EPFVTSENVP HSVMPKNKRP  360
RHFSEVSALD VGKTASNLWS SALTQSHEFA QSCIASQRNS PQQCYREATE DAKNSDWPAI  420
PYSATLNNQM VFPVEQKKPE STASYRLFGI DLLSSFIPAT EEKTAPTLPI NITKPTPDSN  480
SDPKSEVSKL SEEKKQEPAQ ASSKEVQSKE NSSARSRTKV QMQGVPVGRA VDLTVLNGYS  540
ELIDDLEKLF DIEGELKSRN QLEIVFTDDE GDMMLVGDDP WPEFCNVVKR IFIWSKEEVK  600
KMTPGNQLRK LLTEVDTTLT TTISKTENHS N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1621034322355Auxin response factor 1
4ldw_A1e-1621034322355Auxin response factor 1
4ldw_B1e-1621034322355Auxin response factor 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013595232.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794740.0JN979474.1 Brassica rapa subsp. pekinensis auxin response factor 9 (ARF9-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595232.10.0PREDICTED: auxin response factor 9-like
RefseqXP_013706414.10.0auxin response factor 9-like isoform X2
RefseqXP_022561360.10.0auxin response factor 9-like isoform X4
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A0D3DFS60.0A0A0D3DFS6_BRAOL; Auxin response factor
STRINGBo7g109250.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9