PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013593223.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 290aa MW: 31917.7 Da PI: 5.5691 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.6 | 8.1e-20 | 6 | 51 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde+l + v+++G+++W++I++ ++ gR++k+c++rw + XP_013593223.1 6 KGPWSEEEDEQLRRMVEKYGPRNWSAISKSIP-GRSGKSCRLRWCNQ 51 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 51.3 | 2.6e-16 | 60 | 102 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++eEde ++ a +++G++ W+tIar ++ gRt++ +k++w++ XP_013593223.1 60 PFSAEEDETILSARAKFGNR-WATIARLLN-GRTDNAVKNHWNST 102 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 30.236 | 1 | 56 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.65E-31 | 3 | 99 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-18 | 5 | 54 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-19 | 6 | 51 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-26 | 7 | 59 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.68E-18 | 8 | 50 | No hit | No description |
SMART | SM00717 | 1.8E-14 | 57 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.102 | 58 | 107 | IPR017930 | Myb domain |
CDD | cd00167 | 7.34E-12 | 60 | 103 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-21 | 60 | 106 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.2E-13 | 60 | 102 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 290 aa Download sequence Send to blast |
MADRVKGPWS EEEDEQLRRM VEKYGPRNWS AISKSIPGRS GKSCRLRWCN QLSPEVEHRP 60 FSAEEDETIL SARAKFGNRW ATIARLLNGR TDNAVKNHWN STLKRKFVGG GGDCDLVAVT 120 AEEDRRRKRR SVSSESAPLV DTGLYMSPES PTGVSDSSTI PSPVAAQLFK PMPVSGGFTV 180 PSPVEMSSSE EDPATSLSLS LSLPGADVSQ ESRNNSLLFP RFESQVKINV EESEEGRGGE 240 FMRVVQEMIK AEVRSYMSEI QKNSGGFVVG GLYETGNGGF RDSGFITKVE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 5e-40 | 5 | 107 | 3 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 4e-40 | 5 | 107 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 4e-40 | 5 | 107 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00400 | DAP | Transfer from AT3G50060 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013593223.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC966743 | 1e-109 | KC966743.1 Brassica napus MYB transcription factor 77 (MYB77.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013593223.1 | 0.0 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | Q9SN12 | 1e-141 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A0D3DDR7 | 0.0 | A0A0D3DDR7_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6EXG6 | 0.0 | A0A3P6EXG6_BRAOL; Uncharacterized protein | ||||
STRING | Bo7g099180.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13598 | 15 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 1e-122 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|