PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013590494.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 183aa MW: 21096.6 Da PI: 9.516 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 132.7 | 1.2e-41 | 64 | 139 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cqv++C++dl+e k+yhrrhkvCevh+ka++v+++g+ qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++ XP_013590494.1 64 CQVDRCTTDLKEDKQYHRRHKVCEVHAKASSVYLAGVIQRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKSS 139 **************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 2.1E-57 | 1 | 151 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 8.3E-32 | 58 | 125 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.701 | 61 | 138 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 6.41E-38 | 63 | 142 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 5.3E-32 | 64 | 137 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MEGKKAQGLG YLKKKASMSS YQVDEELEND TEEEEEVERE EEKRKGVMDR SKGSSSNRVS 60 SRLCQVDRCT TDLKEDKQYH RRHKVCEVHA KASSVYLAGV IQRFCQQCSR FHELPEFDEA 120 KRSCRRRLAG HNERRRKSSG ESFGEGSGGR RGVTGQVMQN QERSKVEMTL PMSNSSFKRP 180 QIR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-43 | 55 | 137 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the inflorescence apical meristem and young flowers. {ECO:0000269|PubMed:10524240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013590494.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353439 | 1e-108 | AK353439.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-30-M04. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013590494.1 | 1e-131 | PREDICTED: squamosa promoter-binding-like protein 4 isoform X2 | ||||
Swissprot | Q9S758 | 1e-84 | SPL5_ARATH; Squamosa promoter-binding-like protein 5 | ||||
TrEMBL | A0A0D3CQD0 | 1e-130 | A0A0D3CQD0_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6GXV3 | 1e-130 | A0A3P6GXV3_BRAOL; Uncharacterized protein | ||||
STRING | Bo6g029290.1 | 1e-131 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 1e-60 | squamosa promoter binding protein-like 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|