PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013590486.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 211aa MW: 23928.7 Da PI: 8.0472 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 81.8 | 4.5e-26 | 9 | 57 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 krien rqvtf+kRr+g+lKKA+ELSvLCdaev v+ifs++gkl+e XP_013590486.1 9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEVGVMIFSPQGKLFEL 57 79********************************************996 PP | |||||||
2 | K-box | 58.4 | 3e-20 | 100 | 181 | 19 | 100 |
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +++ Lk+ei++Lq+ +R + G + ++++l+eL Le++Le +++iRs K+e++l++i+ l++ e l+++nk+L +k+ee XP_013590486.1 100 DQVNELKQEIDMLQKGIRYMFGGGDGTMNLQELLLLEKHLEYWISHIRSAKMEIMLQEIQSLRNTEGVLKNANKYLLEKIEE 181 6899***************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.0E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.885 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.35E-28 | 1 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.56E-39 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 2.8E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.6E-24 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.313 | 95 | 185 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.5E-19 | 99 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MARGKIQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD AEVGVMIFSP QGKLFELATK 60 GTMEGMIAKY MKCTGGGRGS SSATFTAQEQ LQPPNLDPKD QVNELKQEID MLQKGIRYMF 120 GGGDGTMNLQ ELLLLEKHLE YWISHIRSAK MEIMLQEIQS LRNTEGVLKN ANKYLLEKIE 180 ENNNSVLDAN FATVETNYSY PLTMPSEIFE F |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-16 | 1 | 70 | 1 | 69 | MEF2C |
5f28_B | 3e-16 | 1 | 70 | 1 | 69 | MEF2C |
5f28_C | 3e-16 | 1 | 70 | 1 | 69 | MEF2C |
5f28_D | 3e-16 | 1 | 70 | 1 | 69 | MEF2C |
6byy_A | 3e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 3e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 3e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 3e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 4e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 4e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 4e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 4e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269|PubMed:11855641}. | |||||
Uniprot | TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269|PubMed:11855641, ECO:0000269|PubMed:18203871, ECO:0000269|PubMed:7549482}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013590486.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK228190 | 0.0 | AK228190.1 Arabidopsis thaliana mRNA for MADS-box protein AGL12, complete cds, clone: RAFL14-63-K22. | |||
GenBank | BT006157 | 0.0 | BT006157.1 Arabidopsis thaliana clone RAFL17-04-C08 (R50439) putative MADS-box protein (At1g71692) mRNA, complete cds. | |||
GenBank | BT008332 | 0.0 | BT008332.1 Arabidopsis thaliana At1g71692 gene, complete cds. | |||
GenBank | BT008524 | 0.0 | BT008524.1 Arabidopsis thaliana clone U50439 putative MADS-box protein (At1g71692) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013590486.1 | 1e-157 | PREDICTED: agamous-like MADS-box protein AGL12 | ||||
Swissprot | Q38841 | 1e-135 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | A0A0D3CXA4 | 1e-156 | A0A0D3CXA4_BRAOL; Uncharacterized protein | ||||
STRING | Bo6g094120.1 | 1e-156 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7052 | 26 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 1e-138 | AGAMOUS-like 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|