PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013590290.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 256aa MW: 30123.3 Da PI: 8.309 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.1 | 3.6e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g++KKA+E+SvLCdaeva+++fs++gkl+eys+ XP_013590290.1 9 KRIENKINRQVTFSKRRAGLFKKAHEISVLCDAEVALVVFSHKGKLFEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 107.1 | 2.1e-35 | 79 | 174 | 5 | 100 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + + e+ + +++ e+++Lk++ie L+r+qRh+lGedL+ +s keLq+LeqqL+++lk+iRs+Kn+l++++++elq+kek++qe+n +L+k+++ XP_013590290.1 79 QLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRSRKNQLMYDSVNELQRKEKAIQEQNSMLSKQIK 173 555556667889*********************************************************************************98 PP K-box 100 e 100 e XP_013590290.1 174 E 174 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.6E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.17 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.94E-43 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 3.14E-34 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.3E-30 | 85 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.894 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 256 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRAGLFK KAHEISVLCD AEVALVVFSH KGKLFEYSTD 60 SCMEKILERY ERYSYAERQL IAPESDVNTN WSMEYNRLKA KIELLERNQR HYLGEDLQAM 120 SPKELQNLEQ QLDTALKHIR SRKNQLMYDS VNELQRKEKA IQEQNSMLSK QIKEREKVLM 180 AQQEQWDQQN HGQNMPSPPP PQQHQIQHPY MLSHQPSPFL NMGGLYQEED PMAMRRNDLD 240 LSLEPVYNCN LGCFAA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates in floral primordia and is maintained at a maximal level at the floral bud stage of arrest. {ECO:0000269|PubMed:18332227}. | |||||
Uniprot | DEVELOPMENTAL STAGE: First observed in young floral meristem before organs initiation. Accumulates strongly in the sepals of the early stage bud. In more mature buds, expressed on the adaxial side of the sepals, in the petal primordia, and transiently in young stamen primordia. {ECO:0000269|PubMed:9084216}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in some of the meristems of arrest-stage broccoli heads. {ECO:0000269|PubMed:9084216}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in some of the meristems of arrest-stage cauliflower heads. {ECO:0000269|PubMed:9084216}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013590290.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ505846 | 0.0 | AJ505846.1 Brassica oleracea var. botrytis mRNA for MADS-box protein AP1-c. | |||
GenBank | BOU67451 | 0.0 | U67451.1 Brassica oleracea homeotic protein boi1AP1 (Boi1AP1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013590290.1 | 0.0 | PREDICTED: floral homeotic protein APETALA 1 C | ||||
Swissprot | B4YPV4 | 0.0 | AP1C_BRAOA; Floral homeotic protein APETALA 1 C | ||||
Swissprot | Q8GTF4 | 0.0 | AP1C_BRAOB; Floral homeotic protein APETALA 1 C | ||||
Swissprot | Q96355 | 0.0 | 1AP1_BRAOT; Floral homeotic protein APETALA 1-1 | ||||
TrEMBL | A0A078H7V2 | 0.0 | A0A078H7V2_BRANA; BnaC06g29980D protein | ||||
TrEMBL | A0A0D3CZ60 | 0.0 | A0A0D3CZ60_BRAOL; Uncharacterized protein | ||||
STRING | Bo6g108600.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM792 | 25 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-165 | MIKC_MADS family protein |