PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013585324.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family STAT
Protein Properties Length: 676aa    MW: 76147.9 Da    PI: 4.7039
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013585324.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT177.22.4e-552243341111
            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkky 95 
                     ldvvl+na+gqpv+kdv+vvasLlya+sg++vek++d eapLL+sydGvefs+ed+p+ ll+G+as+klkisq  skcd+rLf+ikfeip+  +y
  XP_013585324.1 224 LDVVLSNAIGQPVRKDVQVVASLLYANSGTPVEKTSDLEAPLLVSYDGVEFSAEDKPCTLLNGCASLKLKISQHYSKCDKRLFCIKFEIPNNGSY 318
                     8********************************************************************************************** PP

            STAT  96 pfleavskpirCisrs 111
                     pflea+++++rCisr+
  XP_013585324.1 319 PFLEAFTNQMRCISRT 334
                     **************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2001.5E-525149IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF133859.2E-827172No hitNo description
SuperFamilySSF498991.9E-829166IPR013320Concanavalin A-like lectin/glucanase domain
CDDcd103385.71E-66571676No hitNo description
Gene3DG3DSA:3.30.505.109.6E-8579629IPR000980SH2 domain
SuperFamilySSF555501.51E-11579667IPR000980SH2 domain
PROSITE profilePS5000110.048582635IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MADGCALDTE KYSLLEDFNV DVEVEKQEFE TFSLCFWVYL LDSTTYPSTI IRQVHSDMSF  60
SAPFLVLDEN KKMILLPLTL LHKEAPDPVN TASWTEVPNV STTAEFPLQR WVHVGCEVSR  120
NYMRLYICGK KVGEKVLTSV MTNGTNSDNV RRVSLFSVGG DGYSVQGFIH CAQVLPSTVH  180
VNNHYTKDPP LWLSVEKPST CEVDEDGVWS IVGEKASCGM IFSLDVVLSN AIGQPVRKDV  240
QVVASLLYAN SGTPVEKTSD LEAPLLVSYD GVEFSAEDKP CTLLNGCASL KLKISQHYSK  300
CDKRLFCIKF EIPNNGSYPF LEAFTNQMRC ISRTGGDSVT PKRLSPLVEG VPSRNGASDS  360
SLSMKRIKLG EEKIPESEFE GGNGTSMEWG PQNQDEEEEE EEEEEEDQSS TDSDNTEVRG  420
SMGSRRYTIS DSTIFKYCLG NLTERSLIMK EITNNAGDEE VSEFADQVSL YSGCSHHGYQ  480
IKMARKLIAE GTNAWILISR NYQNVHWDNV VIEIEEHFMR IANCSSRSLT HQDFELLRRI  540
CGCYDYITQE NFEKMWCWLF PVATSISRGL INGMWRSCSP KWIEGFVTKE EAEHSLQSQE  600
PGTFILRFPT SRSWPHPDAG SLVVTYVGRD FVIRHRLLAV DHICDSSERY TDAKPLQDML  660
LAEPELSRLG RIVRSI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1361368LSMKRIKL
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:15073273}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013585324.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0461800.0BT046180.1 Arabidopsis thaliana unknown protein (At1g17040) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585324.10.0PREDICTED: uncharacterized protein LOC106294314
RefseqXP_013585325.10.0PREDICTED: uncharacterized protein LOC106294314
SwissprotB5X5610.0SHA_ARATH; SH2 domain-containing protein A
TrEMBLA0A0D3CAX30.0A0A0D3CAX3_BRAOL; Uncharacterized protein
STRINGBo5g022370.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52052645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]