PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_013585006.1

Organism

Brassica oleracea

Taxonomic ID

3712

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

WOX

Protein Properties

Length: 191aa MW: 22471.1 Da PI: 9.0645

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013585006.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	64.3	1.7e-20	23	84	1	57
TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++ R+++t eql++L +lF+ r+p+++++++++++l +++ ++V++WFqN++a+e++ XP_013585006.1 23 KCGRWNPTVEQLKILTDLFRAgLRTPTTDQIQKISTELsfygKIESKNVFYWFQNHKARERQ 84 568***************99************************************97 PP
2	Wus_type_Homeobox	114	7.4e-37	23	86	2	65
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 ++ RW+Pt eQ+kiL++l+++GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk+ XP_013585006.1 23 KCGRWNPTVEQLKILTDLFRAGLRTPTTDQIQKISTELSFYGKIESKNVFYWFQNHKARERQKR 86 678***********************************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	10.641	20	85	IPR001356	Homeobox domain
SMART	SM00389	6.2E-4	22	89	IPR001356	Homeobox domain
Pfam	PF00046	1.7E-17	24	84	IPR001356	Homeobox domain
SuperFamily	SSF46689	2.35E-11	25	88	IPR009057	Homeodomain-like
CDD	cd00086	0.00112	26	86	No hit	No description
Gene3D	G3DSA:1.10.10.60	9.2E-8	26	84	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009733	Biological Process	response to auxin
GO:0010078	Biological Process	maintenance of root meristem identity
GO:1902459	Biological Process	positive regulation of stem cell population maintenance
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 191 aa Download sequence Send to blast
MSFPLKVRSV RGNNGGGGGT GTKCGRWNPT VEQLKILTDL FRAGLRTPTT DQIQKISTEL 60 SFYGKIESKN VFYWFQNHKA RERQKRRKIS IDFDHHHQEN DYISHHHHHR QPSTRDVFEI 120 NEDEEERVIE TLQLFPVNSF QESKVDKMRS RVNNQYRDYI RETNTTTFPS YSSCGAEMEH 180 PSPLELRLSF L

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Specifically expressed in the hypophysis of the majority of early globular embryos, approximately one round of cell division after the 16-cell stage, but never at the 16-cell stage itself. After the division of the hypophysis, it is detected in the upper lens-shaped cell that gives rise to the QC, but not in the lower daughter cell that gives rise to the central root cap. Subsequently, in heart stage and bent cotyledon stage embryos, it is detected in the four cells of the QC, which are the direct descendants of the lens-shaped cell. Also expressed in patches of cells that appeared associated with the vascular primordium of the cotyledons. This expression is strongest in late heart stage embryos and then gradually decreases. {ECO:0000269\|PubMed:14711878}.
Uniprot	TISSUE SPECIFICITY: Specifically expressed in the central cells of a quiescent center (QC) of the root. {ECO:0000269\|PubMed:14711878}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor, which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269\|PubMed:25631790}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_013585006.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF601769	0.0	KF601769.1 Raphanus sativus WUSCHEL-related homeobox 5 (WOX5) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013585006.1	1e-143	PREDICTED: WUSCHEL-related homeobox 5
Swissprot	Q8H1D2	1e-107	WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBL	A0A0D3CL84	1e-141	A0A0D3CL84_BRAOL; Uncharacterized protein
TrEMBL	A0A3P6FI43	1e-141	A0A3P6FI43_BRAOL; Uncharacterized protein
STRING	Bo5g136700.1	1e-142	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4014	28	57

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G11260.1	3e-89	WUSCHEL related homeobox 5

Publications ? help Back to Top
Conte MG,Gaillard S,Droc G,Perin C Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants. BMC Genomics, 2008. 9: p. 183 [PMID:18426584] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Tian H,Niu T,Yu Q,Quan T,Ding Z Auxin gradient is crucial for the maintenance of root distal stem cell identity in Arabidopsis. Plant Signal Behav, 2013. 8(12): p. e26429 [PMID:24056047] Tian H,Jia Y,Niu T,Yu Q,Ding Z The key players of the primary root growth and development also function in lateral roots in Arabidopsis. Plant Cell Rep., 2014. 33(5): p. 745-53 [PMID:24504658] Reyes-Hernández BJ, et al. The root indeterminacy-to-determinacy developmental switch is operated through a folate-dependent pathway in Arabidopsis thaliana. New Phytol., 2014. 202(4): p. 1223-36 [PMID:24635769] Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342] Ji H, et al. PRL1 modulates root stem cell niche activity and meristem size through WOX5 and PLTs in Arabidopsis. Plant J., 2015. 81(3): p. 399-412 [PMID:25438658] Su YH,Liu YB,Bai B,Zhang XS Establishment of embryonic shoot-root axis is involved in auxin and cytokinin response during Arabidopsis somatic embryogenesis. Front Plant Sci, 2014. 5: p. 792 [PMID:25642237] Jia Y, et al. The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development. J. Exp. Bot., 2015. 66(15): p. 4631-42 [PMID:25998905] Zhang M, et al. A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis. Plant J., 2015. 83(4): p. 582-99 [PMID:26072661] Kong X,Lu S,Tian H,Ding Z WOX5 is Shining in the Root Stem Cell Niche. Trends Plant Sci., 2015. 20(10): p. 601-603 [PMID:26440429] Hu X,Xu L Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis. Plant Physiol., 2016. 172(4): p. 2363-2373 [PMID:27784768] Zhang Y,Jiao Y,Jiao H,Zhao H,Zhu YX Two-Step Functional Innovation of the Stem-Cell Factors WUS/WOX5 during Plant Evolution. Mol. Biol. Evol., 2017. 34(3): p. 640-653 [PMID:28053005] Singh S, et al. Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components. Sci Rep, 2017. 7: p. 42450 [PMID:28195159] García-Gómez ML,Azpeitia E,Álvarez-Buylla ER A dynamic genetic-hormonal regulatory network model explains multiple cellular behaviors of the root apical meristem of Arabidopsis thaliana. PLoS Comput. Biol., 2017. 13(4): p. e1005488 [PMID:28426669] Long Y, et al. In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots. Nature, 2017. 548(7665): p. 97-102 [PMID:28746306] Bruno L, et al. In Arabidopsis thaliana Cadmium Impact on the Growth of Primary Root by Altering SCR Expression and Auxin-Cytokinin Cross-Talk. Front Plant Sci, 2017. 8: p. 1323 [PMID:28798767] Hu B, et al. Divergent regeneration-competent cells adopt a common mechanism for callus initiation in angiosperms. Regeneration (Oxf), 2017. 4(3): p. 132-139 [PMID:28975033] Lozano-Elena F,Planas-Riverola A,Vilarrasa-Blasi J,Schwab R,Caño-Delgado AI Paracrine brassinosteroid signaling at the stem cell niche controls cellular regeneration. J. Cell. Sci., 2019. [PMID:29242230] Xu C, et al. Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration. Nat Plants, 2018. 4(2): p. 108-115 [PMID:29358751] Dolzblasz A, et al. Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4. Int J Mol Sci, 2018. [PMID:29538317]