PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013584811.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 198aa MW: 23065.3 Da PI: 5.6686 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 42.4 | 1.6e-13 | 88 | 138 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 +++rr+++NRe+ArrsR RK+ ++eL v L + N+ L+++l++ ++ XP_013584811.1 88 RKQRRMISNRESARRSRMRKQRHLDELWSHVIRLRTDNHCLIDKLNRVSES 138 79*******************************************998875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.3E-13 | 84 | 148 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.898 | 86 | 138 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 4.9E-11 | 86 | 137 | No hit | No description |
Pfam | PF00170 | 2.0E-11 | 88 | 139 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.69E-11 | 88 | 138 | No hit | No description |
CDD | cd14702 | 3.71E-18 | 89 | 140 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 91 | 106 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MNTIPAELTG YFQYVSPEIY NNQTPITESE YFKMPSSPTS ASSFYYINGL MTNNNNNYSS 60 SSNVQDPVTS NNSTSDDDHQ QSMVIDERKQ RRMISNRESA RRSRMRKQRH LDELWSHVIR 120 LRTDNHCLID KLNRVSESHQ LALKENAKLK EETSNLKQLI SEIKSNNEDD NNFLRELEDS 180 ISNSRSDLNQ MGRDFELC |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 100 | 107 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013584811.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC027134 | 0.0 | AC027134.4 Arabidopsis thaliana chromosome I BAC F13B4 genomic sequence, complete sequence. | |||
GenBank | AF332430 | 0.0 | AF332430.1 Arabidopsis thaliana clone C00105 (e) putative bZIP transcription factor (At1g13600) mRNA, complete cds. | |||
GenBank | CP002684 | 0.0 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
GenBank | F21F23 | 0.0 | AC027656.4 Sequence of BAC F21F23 from Arabidopsis thaliana chromosome 1, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013584811.1 | 1e-144 | PREDICTED: basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 1e-31 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A0D3C9U4 | 1e-143 | A0A0D3C9U4_BRAOL; Uncharacterized protein | ||||
STRING | Bo5g017580.1 | 1e-144 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2892 | 24 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G13600.1 | 1e-116 | basic leucine-zipper 58 |
Publications ? help Back to Top | |||
---|---|---|---|
|