PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013583909.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 250aa MW: 28517.6 Da PI: 5.1823 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.5 | 2.2e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l+ ++++G ++W++ ++ g+ R++k+c++rw +yl XP_013583909.1 14 KGPWSAEEDRILISHIRLHGHPNWRALPQLAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 53.1 | 7.3e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E+e ++++++ lG++ W++Ia++++ gRt++++k+ w+++l XP_013583909.1 67 RGNFTPQEEETIINLHQSLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.6E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.221 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.71E-29 | 10 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.9E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.04E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.903 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.3E-27 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.1E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.42E-9 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 250 aa Download sequence Send to blast |
MGRRPCCEKM GLKKGPWSAE EDRILISHIR LHGHPNWRAL PQLAGLLRCG KSCRLRWINY 60 LRPDIKRGNF TPQEEETIIN LHQSLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRIQHNQ 120 DQNISETICD NDEQLVSVMD EKRPSSPQQQ SSSSTNISAV TTSSNNNDVS NNNIKDSATS 180 PEDVLPLIDE SFWSEVVSMD YNISGDEEIK IEDWESSLDS NIKGYNHDME SWFDNLLTSN 240 LTTGENSDIF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-25 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots and flowers. Expressed in shoot apex, axillary buds, at the basis of flowers and branching points of inflorescences. {ECO:0000269|PubMed:9681014}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a regulatory role in meristem function. Functions as component of a regulatory network controlling the establishment and/or development of the shoot system by the regulation of apical meristem function (PubMed:9681014). May play a role in tolerance to boric acid (PubMed:16861809). {ECO:0000269|PubMed:16861809, ECO:0000269|PubMed:9681014}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00127 | DAP | Transfer from AT1G06180 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013583909.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), drought, light and wounding in leaves. Down-regulated by drought and ABA in roots. {ECO:0000269|PubMed:9681014}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF738279 | 0.0 | KF738279.1 Brassica napus MYB transcription factor 13 (MYB13.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001302971.1 | 0.0 | myb-related protein Myb4-like | ||||
Refseq | XP_013583909.1 | 0.0 | PREDICTED: myb-related protein Myb4 | ||||
Swissprot | Q9LNC9 | 1e-128 | MYB13_ARATH; Transcription factor MYB13 | ||||
TrEMBL | A0A078FAV9 | 0.0 | A0A078FAV9_BRANA; BnaC05g04250D protein | ||||
TrEMBL | A0A0D3C814 | 0.0 | A0A0D3C814_BRAOL; Uncharacterized protein | ||||
STRING | Bo5g007320.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06180.1 | 1e-116 | myb domain protein 13 |
Publications ? help Back to Top | |||
---|---|---|---|
|