PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00153494001 | ||||||||
Common Name | GSBRNA2T00153494001, LOC106385976, LOC106443768 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 77aa MW: 8986.23 Da PI: 7.7032 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 30 | 1.2e-09 | 33 | 71 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 + +eE++l + +k+ G + W++Ia +++ gRt+ ++ +w GSBRNA2T00153494001 33 MNQEEEDLVRRMHKLVGDR-WELIAGRIP-GRTAAEIERFW 71 679**************99.*********.********999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 5.1E-4 | 29 | 75 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.90E-6 | 32 | 71 | No hit | No description |
SuperFamily | SSF46689 | 1.01E-7 | 34 | 73 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.1E-11 | 34 | 72 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.5E-8 | 34 | 72 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 77 aa Download sequence Send to blast |
MDKHLRTKQT KTNPILTSSS EEVSSLEWQA VNMNQEEEDL VRRMHKLVGD RWELIAGRIP 60 GRTAAEIERF WVMKYN* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.25129 | 2e-35 | flower |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaf epidermal cells, stomate guard cells in leaves, cotyledons and hypocotyls, inflorescences, developing seeds and siliques. {ECO:0000269|PubMed:18305006}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269|PubMed:18305006}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00153494001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519522 | 2e-65 | AY519522.1 Arabidopsis thaliana MYB transcription factor (At4g01060) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009134506.1 | 1e-50 | PREDICTED: MYB-like transcription factor ETC3 isoform X1 | ||||
Refseq | XP_013628635.1 | 1e-50 | PREDICTED: MYB-like transcription factor ETC3 isoform X1 | ||||
Refseq | XP_013681332.1 | 1e-50 | MYB-like transcription factor ETC3 isoform X1 | ||||
Refseq | XP_013740775.1 | 1e-50 | MYB-like transcription factor ETC3 isoform X1 | ||||
Swissprot | Q9M157 | 1e-31 | ETC3_ARATH; MYB-like transcription factor ETC3 | ||||
TrEMBL | A0A0D3B928 | 3e-49 | A0A0D3B928_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A398A5I8 | 3e-49 | A0A398A5I8_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3P6B7G6 | 3e-49 | A0A3P6B7G6_BRAOL; Uncharacterized protein | ||||
TrEMBL | M4C9R2 | 3e-49 | M4C9R2_BRARP; Uncharacterized protein | ||||
STRING | Bra000941.1-P | 4e-50 | (Brassica rapa) | ||||
STRING | Bo3g054440.1 | 4e-50 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01060.2 | 1e-34 | CAPRICE-like MYB3 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106385976 | 106443768 |