PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00146148001
Common NameGSBRNA2T00146148001, MYB28.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 140aa    MW: 16100.4 Da    PI: 10.0478
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00146148001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.3e-191461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WTteEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
  GSBRNA2T00146148001 14 KGAWTTEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWTNYL 61
                         79********************************************97 PP

2Myb_DNA-binding50.35.4e-1667112148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
  GSBRNA2T00146148001  67 RGEFSSEEEQIIIMLHASRGNK-WSVIARHLP-RRTDNEIKNYWNTHL 112
                          899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129424.586965IPR017930Myb domain
SuperFamilySSF466899.73E-3011108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002493.9E-181461IPR001005SANT/Myb domain
CDDcd001671.72E-101661No hitNo description
Gene3DG3DSA:1.10.10.608.6E-2665117IPR009057Homeodomain-like
PROSITE profilePS5129419.75366116IPR017930Myb domain
SMARTSM007172.5E-1466114IPR001005SANT/Myb domain
PfamPF002492.7E-1467112IPR001005SANT/Myb domain
CDDcd001679.71E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MSRKPCCVGE GLKKGAWTTE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWTNY  60
LKPEIKRGEF SSEEEQIIIM LHASRGNKWS VIARHLPRRT DNEIKNYWNT HLKKRLIEQG  120
TDPVTHKPLA SNTNPSYCT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.289121e-136leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First present in stems, petioles and the main veins of true leaves in young seedlings. Later accumulates in leaves and present in lateral roots. During transition from the vegetative to the generative stage, preferentially expressed in inflorescence. {ECO:0000269|PubMed:17521412}.
UniprotTISSUE SPECIFICITY: Expressed in generative organs, mature leaves and trichomes. {ECO:0000269|PubMed:17521412, ECO:0000269|PubMed:23115560}.
Functional Description ? help Back to Top
Source Description
UniProtMajor regulator of short-chained aliphatic glucosinolates (GLSs) biosynthesis. Together with MYB29/HAG3 and MYB76/HAG2, promotes aliphatic glucosinolate biosynthesis but represses indolic glucosinolate biosynthesis. Prevents insect performance (e.g. lepidopteran insect Mamestra brassicae and Spodoptera exigua) by promoting glucosinolates. {ECO:0000269|PubMed:17420480, ECO:0000269|PubMed:17521412, ECO:0000269|PubMed:18042203, ECO:0000269|PubMed:18446225, ECO:0000269|PubMed:20348214, ECO:0000269|PubMed:23580754, ECO:0000269|PubMed:23792303, ECO:0000269|PubMed:23943862}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00146148001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by glucose, gibberellic acid (GA), jasmonic acid (JA) and salicylic acid (SA). Transiently induced in inflorescence by mechanical stimuli such as touch or wounding, including herbivory-wounding. Up-regulated by sulfur-deficient stress. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17521412, ECO:0000269|PubMed:23115560, ECO:0000269|PubMed:23792303}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6701160.0KJ670116.1 Brassica napus MYB transcription factor 28 (MYB28.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111992.11e-98PREDICTED: transcription factor MYB28 isoform X1
RefseqXP_018510507.13e-99PREDICTED: transcription factor MYB28 isoform X2
SwissprotQ9SPG28e-97MYB28_ARATH; Transcription factor MYB28
TrEMBLA0A078DDC05e-99A0A078DDC0_BRANA; MYB transcription factor 28
TrEMBLA0A397XRJ73e-97A0A397XRJ7_BRACM; Uncharacterized protein
TrEMBLA0A3P5XV493e-97A0A3P5XV49_BRACM; Uncharacterized protein
TrEMBLA0A3P6DM393e-97A0A3P6DM39_BRAOL; Uncharacterized protein
TrEMBLC5HYG03e-97C5HYG0_BRARP; MYB domain protein 28-2
TrEMBLE0X5873e-97E0X587_BRAOT; R2R3 DNA-binding transcription factor MYB28
TrEMBLL8B5213e-97L8B521_BRAOV; Myb transcription factor BoMyb28-2
STRINGBra035929.1-P5e-98(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61420.23e-99myb domain protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kim K,Jiang K,Teng SL,Feldman LJ,Huang H
    Using biologically interrelated experiments to identify pathway genes in Arabidopsis.
    Bioinformatics, 2012. 28(6): p. 815-22
    [PMID:22271267]
  3. Augustine R,Majee M,Gershenzon J,Bisht NC
    Four genes encoding MYB28, a major transcriptional regulator of the aliphatic glucosinolate pathway, are differentially expressed in the allopolyploid Brassica juncea.
    J. Exp. Bot., 2013. 64(16): p. 4907-21
    [PMID:24043856]
  4. Guo R, et al.
    Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana.
    J. Exp. Bot., 2013. 64(18): p. 5707-19
    [PMID:24151308]
  5. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  6. Li F, et al.
    Genome-wide association study dissects the genetic architecture of seed weight and seed quality in rapeseed (Brassica napus L.).
    DNA Res., 2014. 21(4): p. 355-67
    [PMID:24510440]
  7. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  8. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  9. An X, et al.
    Transcriptome profiling and identification of transcription factors in ramie (Boehmeria nivea L. Gaud) in response to PEG treatment, using illumina paired-end sequencing technology.
    Int J Mol Sci, 2015. 16(2): p. 3493-511
    [PMID:25658800]
  10. Burow M, et al.
    The Glucosinolate Biosynthetic Gene AOP2 Mediates Feed-back Regulation of Jasmonic Acid Signaling in Arabidopsis.
    Mol Plant, 2015. 8(8): p. 1201-12
    [PMID:25758208]
  11. Martínez-Ballesta M, et al.
    The impact of the absence of aliphatic glucosinolates on water transport under salt stress in Arabidopsis thaliana.
    Front Plant Sci, 2015. 6: p. 524
    [PMID:26236322]
  12. Seo MS, et al.
    Functional analysis of three BrMYB28 transcription factors controlling the biosynthesis of glucosinolates in Brassica rapa.
    Plant Mol. Biol., 2016. 90(4-5): p. 503-16
    [PMID:26820138]
  13. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  14. Mostafa I, et al.
    New nodes and edges in the glucosinolate molecular network revealed by proteomics and metabolomics of Arabidopsis myb28/29 and cyp79B2/B3 glucosinolate mutants.
    J Proteomics, 2016. 138: p. 1-19
    [PMID:26915584]
  15. Smith JD,Woldemariam MG,Mescher MC,Jander G,De Moraes CM
    Glucosinolates from Host Plants Influence Growth of the Parasitic Plant Cuscuta gronovii and Its Susceptibility to Aphid Feeding.
    Plant Physiol., 2016. 172(1): p. 181-97
    [PMID:27482077]
  16. Aarabi F, et al.
    Sulfur deficiency-induced repressor proteins optimize glucosinolate biosynthesis in plants.
    Sci Adv, 2016. 2(10): p. e1601087
    [PMID:27730214]
  17. Mostafa I, et al.
    Membrane Proteomics of Arabidopsis Glucosinolate Mutants cyp79B2/B3 and myb28/29.
    Front Plant Sci, 2017. 8: p. 534
    [PMID:28443122]
  18. Simon MK,Skinner DJ,Gallagher TL,Gasser CS
    Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors.
    Genetics, 2017. 207(4): p. 1489-1500
    [PMID:28971961]
  19. Li B, et al.
    Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis.
    Plant Cell, 2018. 30(1): p. 178-195
    [PMID:29317470]