PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00144111001 | ||||||||
Common Name | GSBRNA2T00144111001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 69aa MW: 8110.69 Da PI: 11.3089 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 43.1 | 6.9e-14 | 2 | 54 | 296 | 348 |
GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg 348 +v+aceg er++r et+++W+ r+ +aGF+p++l+++++k+ k l+r+ + +g GSBRNA2T00144111001 2 SVIACEGPERFARPETYKQWKVRILRAGFRPAKLNKQIVKERKGLIRERYHKG 54 69*********************************************999777 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 12.683 | 1 | 60 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 2.3E-11 | 2 | 54 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 69 aa Download sequence Send to blast |
MSVIACEGPE RFARPETYKQ WKVRILRAGF RPAKLNKQIV KERKGLIRER YHKGRVYALP 60 CWKPAKKQ* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, leaves, sepals, stamen and pistil, and in the quiescent center of root meristem. {ECO:0000269|PubMed:18500650}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00144111001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009150374.1 | 3e-31 | PREDICTED: scarecrow-like protein 30 isoform X1 | ||||
Swissprot | Q9SNB8 | 7e-30 | SCL30_ARATH; Scarecrow-like protein 30 | ||||
TrEMBL | A0A3P6BD12 | 9e-41 | A0A3P6BD12_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g132720.1 | 2e-38 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46600.1 | 3e-32 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|