PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00143612001 | ||||||||
Common Name | GSBRNA2T00143612001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 93aa MW: 10774.5 Da PI: 8.4993 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 31.2 | 5e-10 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+W++eEd +lv +++++G g+W+t +++ g GSBRNA2T00143612001 14 KGKWSAEEDRILVAYINEYGLGDWRTLPKRAG 45 79**************************9988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.845 | 9 | 54 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.21E-9 | 9 | 45 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.5E-10 | 12 | 45 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.0E-7 | 14 | 45 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.58E-6 | 16 | 45 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
MERTTWFDND GLKKGKWSAE EDRILVAYIN EYGLGDWRTL PKRAGINIYL HPIHMHTLRT 60 DHLGFCSFIR VNWDCIAGLV LNRVFKPVLC NI* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00143612001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013649727.1 | 2e-22 | transcription factor MYB106 |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74430.1 | 6e-20 | myb domain protein 95 |
Publications ? help Back to Top | |||
---|---|---|---|
|