PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00137562001 | ||||||||
Common Name | GSBRNA2T00137562001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 200aa MW: 22613 Da PI: 10.4893 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 174.6 | 2.8e-54 | 17 | 144 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrFhPtdeelvv+yLk+kv++ +l++ +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk GSBRNA2T00137562001 17 LPPGFRFHPTDEELVVHYLKRKVASAPLPV-AIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDK 105 79****************************.88***************999999************************************ PP NAM 91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 +vl++ ++ +vg+kk Lvfy+g+ pkg+k+dW+mheyrl GSBRNA2T00137562001 106 PVLASdGKLKVGVKKALVFYSGKPPKGVKSDWIMHEYRL 144 ***9955667***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.41E-66 | 13 | 179 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 62.033 | 17 | 178 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.1E-29 | 18 | 144 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MKITDSPGGS PPPQPNLPPG FRFHPTDEEL VVHYLKRKVA SAPLPVAIIA EVDLYKFDPW 60 ELPAKASFGE QEWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKPVLAS DGKLKVGVKK 120 ALVFYSGKPP KGVKSDWIMH EYRLIDNKPN NRPPGCDFGN KRNSLRLDDW VLCRIYKKNN 180 ASRHKKSSLV IKWTPPQRL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-74 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-74 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-74 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-74 | 11 | 183 | 11 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-74 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-74 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-74 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-74 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-74 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-74 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-74 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-74 | 11 | 183 | 14 | 173 | NAC domain-containing protein 19 |
4dul_A | 2e-74 | 11 | 183 | 11 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-74 | 11 | 183 | 11 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed throughout anthers from stages 8 to 12. Later confined to distal region of anthers from stage 13. {ECO:0000269|PubMed:16055634}. | |||||
Uniprot | TISSUE SPECIFICITY: Stamen specific, in anthers from stage 8 (PubMed:15100403, PubMed:16055634). Expressed in the outer integument, but seems not expressed in the embryo at the torpedo stage (PubMed:18849494). {ECO:0000269|PubMed:15100403, ECO:0000269|PubMed:16055634, ECO:0000269|PubMed:18849494}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00137562001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353226 | 0.0 | AK353226.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-33-D23. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013741023.1 | 1e-131 | NAC transcription factor 56-like | ||||
Swissprot | Q9LD44 | 1e-116 | NAC56_ARATH; NAC transcription factor 56 | ||||
TrEMBL | A0A3P5ZNP0 | 1e-131 | A0A3P5ZNP0_BRACM; Uncharacterized protein | ||||
STRING | Bra001597.1-P | 1e-130 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM190 | 28 | 276 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15510.1 | 1e-111 | NAC domain containing protein 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|