PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00136579001 | ||||||||
Common Name | GSBRNA2T00136579001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 178aa MW: 19575.5 Da PI: 10.7198 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 277.7 | 5.4e-85 | 7 | 177 | 127 | 301 |
GAGA_bind 127 reeeklealpieeaaeeakekkkkkkrqr.akkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsC 215 ++++++e++p++++++ ++ kk+k +++ ++ +k+kk +k+k+++ ++++++ +r+k kks dlv+ngv++D+s+lPvPvC+C GSBRNA2T00136579001 7 HHHHQTEEHPVKCEPDIVESKKRKPNSKAgGAPTKAKKPRKPKEENG---DSNNANV--SRVKPAKKSFDLVINGVNMDISGLPVPVCTC 91 467889999**999988776666555554045556677777777332...2333333..689**************************** PP GAGA_bind 216 tGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301 tGa++qCY+WG+GGWqSaCCtt+iS++PLP+stkrrgaRi+grKmSqgafkk+LekLa++G++++ p++Lk+hWA+HGtnkfvtir GSBRNA2T00136579001 92 TGAPQQCYRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDGFNFGSPINLKSHWARHGTNKFVTIR 177 *************************************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01226 | 8.0E-87 | 3 | 177 | IPR010409 | GAGA-binding transcriptional activator |
Pfam | PF06217 | 2.3E-80 | 8 | 177 | IPR010409 | GAGA-binding transcriptional activator |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MHMNLHHHHH QTEEHPVKCE PDIVESKKRK PNSKAGGAPT KAKKPRKPKE ENGDSNNANV 60 SRVKPAKKSF DLVINGVNMD ISGLPVPVCT CTGAPQQCYR WGCGGWQSAC CTTNISMHPL 120 PMSTKRRGAR ISGRKMSQGA FKKVLEKLAS DGFNFGSPIN LKSHWARHGT NKFVTIR* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.1522 | 0.0 | flower| root| seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal and petal vasculature, in pollen grains, in young rosette, in the lateral and tip of primary roots, and in ovule at the exception of the outer integument. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00136579001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189499 | 1e-124 | AC189499.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB086M23, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013600190.1 | 1e-129 | PREDICTED: protein BASIC PENTACYSTEINE2-like isoform X2 | ||||
Refseq | XP_013707903.1 | 1e-129 | protein BASIC PENTACYSTEINE2-like isoform X2 | ||||
Swissprot | Q9LDE2 | 3e-93 | BPC2_ARATH; Protein BASIC PENTACYSTEINE2 | ||||
TrEMBL | A0A3P6GGD3 | 1e-128 | A0A3P6GGD3_BRAOL; Uncharacterized protein | ||||
STRING | Bo8g106640.1 | 1e-128 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2893 | 27 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14685.3 | 5e-89 | basic pentacysteine 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|