PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00136327001

Common Name

GSBRNA2T00136327001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB_related

Protein Properties

Length: 130aa MW: 14819.6 Da PI: 6.8064

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00136327001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	34.6	4.3e-11	91	128	3	40
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40 +W++ E++l++ + k++G+g+W++I+r + +Rt+ q+ GSBRNA2T00136327001 91 PWSESEHKLFLVGLKRYGKGDWRSISRNVVVTRTPTQV 128 8**********************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	7.976	1	55	IPR017930	Myb domain
SMART	SM00717	6.4E-7	2	53	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.58E-12	4	59	IPR009057	Homeodomain-like
CDD	cd00167	3.73E-5	6	51	No hit	No description
PROSITE profile	PS51294	15.359	84	129	IPR017930	Myb domain
SuperFamily	SSF46689	7.18E-9	85	128	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	5.4E-8	87	129	IPR006447	Myb domain, plants
SMART	SM00717	0.25	88	129	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-9	90	128	IPR009057	Homeodomain-like
Pfam	PF00249	2.0E-9	91	128	IPR001005	SANT/Myb domain
CDD	cd00167	7.80E-8	91	128	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
MAASQWTRSE DKMFEHALVL FPEGSPNRWE IIADQLQKSA GEVREHYEAL VHDVIEIDSG 60 RVHVPRYMDD SAGQISFESK HGENERKRGT PWSESEHKLF LVGLKRYGKG DWRSISRNVV 120 VTRTPTQVA*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269\|PubMed:11937495}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269\|PubMed:11937495, ECO:0000269\|PubMed:9118809}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00136327001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009122571.1	2e-90	PREDICTED: transcription factor DIVARICATA-like
Swissprot	Q8S9H7	4e-39	DIV_ANTMA; Transcription factor DIVARICATA
TrEMBL	M4CYY5	4e-89	M4CYY5_BRARP; Uncharacterized protein
STRING	Bra009432.1-P	6e-90	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5127	27	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G04760.1	5e-77	MYB family protein

Publications ? help Back to Top
Galego L,Almeida J Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers. Genes Dev., 2002. 16(7): p. 880-91 [PMID:11937495] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Almeida J,Rocheta M,Galego L Genetic control of flower shape in Antirrhinum majus. Development, 1997. 124(7): p. 1387-92 [PMID:9118809]