PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00131974001 | ||||||||
Common Name | GSBRNA2T00131974001, LOC106405265 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 248aa MW: 28290.6 Da PI: 6.5185 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.3 | 1.3e-16 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd++l+ ++++G ++W++ ++ g+ R++k+c++rw +yl GSBRNA2T00131974001 16 RGPWSPEEDLKLISFIQKFGHENWRSLPKQSGLLRCGKSCRLRWINYL 63 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.7 | 9.8e-17 | 69 | 112 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++T+eE+e ++++++ +G++ W++Ia+ ++ gRt++++k+ w++ GSBRNA2T00131974001 69 RGNFTAEEEETIIKLHQNYGNK-WSRIASQLP-GRTDNEIKNVWHT 112 89********************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-24 | 7 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.411 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.58E-30 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-13 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-15 | 16 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.09E-10 | 18 | 63 | No hit | No description |
PROSITE profile | PS51294 | 25.195 | 64 | 118 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-27 | 67 | 119 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.1E-14 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.1E-15 | 69 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.21E-9 | 71 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 248 aa Download sequence Send to blast |
MGKGRAPCCD KTKVKRGPWS PEEDLKLISF IQKFGHENWR SLPKQSGLLR CGKSCRLRWI 60 NYLRPDVKRG NFTAEEEETI IKLHQNYGNK WSRIASQLPG RTDNEIKNVW HTRLKKRLVQ 120 SSETSPCSSN SVSCGKEDKS QAEGCLNKKT SQDFTTSVSS GGSYNSNQED DPKIGLLFKY 180 SVFNDIIQEV DKPDLLEIPF DSDPDIWSFL DSSNSLQQSG ANEFRAEQES DEDEVKKWFK 240 HMESELE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-26 | 16 | 118 | 7 | 108 | B-MYB |
1gv2_A | 6e-26 | 16 | 118 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 6e-26 | 16 | 118 | 4 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 6e-26 | 16 | 118 | 4 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In nonelongating internodes, highly expressed in interfascicular fibers and xylem cells but not in parenchymatous pith cells. In elongating internodes, predominantly expressed in interfascicular fibers. Accumulates in the developing secondary xylem of roots. {ECO:0000269|PubMed:19122102}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at low levels in stems, roots and siliques (PubMed:9839469). Specifically expressed in fibers and vessels undergoing secondary wall thickening, especially in inflorescence stems (PubMed:19122102). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00131974001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by UV light (PubMed:9839469). Triggered by salicylic acid and jasmonic acid (PubMed:16463103). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232445 | 0.0 | AC232445.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB006F18, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013590896.1 | 0.0 | PREDICTED: myb-related protein Zm1-like | ||||
Refseq | XP_013701293.1 | 0.0 | transcription factor MYB63 | ||||
Swissprot | Q6R0A6 | 1e-131 | MYB63_ARATH; Transcription factor MYB63 | ||||
TrEMBL | A0A0D3CVU8 | 0.0 | A0A0D3CVU8_BRAOL; Uncharacterized protein | ||||
STRING | Bo6g081140.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79180.1 | 1e-134 | myb domain protein 63 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106405265 |
Publications ? help Back to Top | |||
---|---|---|---|
|