PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00126815001 | ||||||||
Common Name | GSBRNA2T00020469001, GSBRNA2T00020472001, GSBRNA2T00126814001, GSBRNA2T00126815001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 78aa MW: 8763.1 Da PI: 10.6745 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 100.5 | 1.1e-31 | 21 | 76 | 5 | 60 |
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 + cprC+s+ntkfCyy n slsqPry Ck+C r Wt+G alrn+P+G+g rk k+ GSBRNA2T00126815001 21 PRICPRCNSDNTKFCYYTNSSLSQPRYICKNCLRLWTHGKALRNIPIGSGGRKTKR 76 567**************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 3.0E-19 | 19 | 76 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 24.642 | 22 | 76 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 7.3E-28 | 23 | 76 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MNTSHVFVSA NHQVNGEKPP PRICPRCNSD NTKFCYYTNS SLSQPRYICK NCLRLWTHGK 60 ALRNIPIGSG GRKTKRI* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.11231 | 1e-123 | seed |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00126815001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006413832.1 | 1e-36 | dof zinc finger protein DOF4.4 | ||||
Swissprot | Q9SUA9 | 4e-30 | DOF44_ARATH; Dof zinc finger protein DOF4.4 | ||||
TrEMBL | A0A078CGR7 | 1e-50 | A0A078CGR7_BRANA; BnaC03g64450D protein | ||||
TrEMBL | A0A397YA53 | 1e-50 | A0A397YA53_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3P6BKN8 | 1e-50 | A0A3P6BKN8_BRAOL; Uncharacterized protein | ||||
TrEMBL | M4DWI6 | 1e-50 | M4DWI6_BRARP; Uncharacterized protein | ||||
STRING | Bra020880.1-P | 2e-51 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM21512 | 2 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21050.1 | 1e-32 | Dof-type zinc finger domain-containing protein |
Publications ? help Back to Top | |||
---|---|---|---|
|