PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00124582001 | ||||||||
Common Name | GSBRNA2T00124582001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 184aa MW: 21598.9 Da PI: 10.5113 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 33.3 | 1e-10 | 70 | 104 | 3 | 37 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvke 37 ++kr+rr+ +NRe+Ar sR+RK++++ e + vk GSBRNA2T00124582001 70 DVKRARRMLSNRESARCSRRRKQEQMSEFDTQVKM 104 68**************************9999985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.2E-4 | 68 | 131 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.8E-8 | 71 | 104 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.06E-7 | 72 | 113 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 3.4E-6 | 72 | 110 | No hit | No description |
CDD | cd14702 | 6.81E-9 | 73 | 103 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MDGVVFYCSR LRCCTNLTRL LHLDLIPQQA FKRNQMLQPG KLPVFHHEMI LMTMILMETQ 60 KRADNGDLTD VKRARRMLSN RESARCSRRR KQEQMSEFDT QVKMAEETVK RVTRVNPSRW 120 TRTNMDIPLK RAIPSTADAG LGPYQRVDKP DFLPEQLNRE SIQNQIDTNP NIFETLPHWR 180 HKH* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 86 | 91 | SRRRKQ |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First observed in seeds at early stages of development, mostly in embryo and, at lower extent, in the endosperm. Accumulates and peaks at maturation. Fade out during late seed development steps, restricted to the inner layer of the seed coat, and, at very low levels, in the mature embryo and the remaining endosperm. Also present in the lignified inner subepidermal layer of the valves. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, shoots, stems, leaves, stipulae, siliques, seeds, pollen, and flowers. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'-ACGT-3' box, especially present in G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of seed storage protein (SSP) encoding gene promoters (e.g. At2S and CRU3) and promotes their expression in seeds when in complex with ABI3 and BZIP53. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:19261733, ECO:0000269|PubMed:19531597}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00124582001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189617 | 2e-83 | AC189617.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH102A07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006403555.1 | 5e-33 | basic leucine zipper 25 isoform X1 | ||||
Swissprot | Q9M1G6 | 3e-27 | BZP25_ARATH; Basic leucine zipper 25 | ||||
TrEMBL | A0A078F2E6 | 1e-135 | A0A078F2E6_BRANA; BnaC06g15330D protein | ||||
STRING | XP_006403555.1 | 2e-32 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5848 | 26 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54620.3 | 5e-32 | basic leucine zipper 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|