PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00118005001 | ||||||||
Common Name | GSBRNA2T00118005001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 278aa MW: 32452.9 Da PI: 7.2831 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.7 | 4.8e-31 | 30 | 80 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g++KKA+E+SvLCdaeva+++fs++gkl+eys+ GSBRNA2T00118005001 30 KRIENKINRQVTFSKRRAGLMKKAHEISVLCDAEVALVVFSHKGKLFEYST 80 79***********************************************96 PP | |||||||
2 | K-box | 108.6 | 6.9e-36 | 98 | 195 | 3 | 100 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 +++ + e+ + +++ e+++Lk++ie L+r+qRh+lGedL+ +s keLq+LeqqL+++lk+iRs+Kn+l++++i+elq+kek++qe+n GSBRNA2T00118005001 98 ERQLIAPESDSNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRSRKNQLMYDSINELQRKEKAIQEQNS 187 5566666677789***************************************************************************** PP K-box 93 aLrkklee 100 +L+k+++e GSBRNA2T00118005001 188 MLSKQIKE 195 *****987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.8E-40 | 22 | 81 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.127 | 22 | 82 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.97E-43 | 23 | 100 | No hit | No description |
SuperFamily | SSF55455 | 1.83E-34 | 23 | 112 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-30 | 24 | 44 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 24 | 78 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.0E-26 | 31 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-30 | 44 | 59 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-30 | 59 | 80 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.5E-30 | 105 | 193 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 17.189 | 109 | 199 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 278 aa Download sequence Send to blast |
MQSEGDTWDG PVEIVPLKGI KMGRGRVQLK RIENKINRQV TFSKRRAGLM KKAHEISVLC 60 DAEVALVVFS HKGKLFEYST DSCMEKILER YERYSYAERQ LIAPESDSNT NWSMEYNRLK 120 AKIELLERNQ RHYLGEDLQA MSPKELQNLE QQLDTALKHI RSRKNQLMYD SINELQRKEK 180 AIQEQNSMLS KQIKERENVL RAQQEQWDEQ NHGHNMPPPP PPQQHQIQHP YMLSHQPSPF 240 LNMGGLYQEE DQMAMRRNDL DLSLEPVYNC NLGCFAA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 3e-22 | 22 | 95 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 3e-22 | 22 | 95 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 3e-22 | 22 | 95 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 3e-22 | 22 | 95 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 3e-22 | 22 | 95 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 3e-22 | 22 | 95 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 3e-22 | 22 | 95 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 3e-22 | 22 | 95 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.16659 | 0.0 | leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates in floral primordia and is maintained at a maximal level at the floral bud stage of arrest. {ECO:0000269|PubMed:18332227}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00118005001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold shock (e.g. from 22/17 to 16/12 degrees Celsius in light/night respectively). {ECO:0000269|PubMed:18332227}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ505845 | 0.0 | AJ505845.1 Brassica oleracea var. botrytis mRNA for MADS-box protein AP1-a. | |||
GenBank | BOU67452 | 0.0 | U67452.1 Brassica oleracea homeotic protein boi2AP1 (Boi2AP1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013589842.1 | 0.0 | PREDICTED: floral homeotic protein APETALA 1 A | ||||
Refseq | XP_013695795.1 | 0.0 | floral homeotic protein APETALA 1 A | ||||
Swissprot | B4YPW6 | 0.0 | AP1A_BRAOA; Floral homeotic protein APETALA 1 A | ||||
Swissprot | Q8GTF5 | 0.0 | AP1A_BRAOB; Floral homeotic protein APETALA 1 A | ||||
Swissprot | Q96356 | 0.0 | 2AP1_BRAOT; Floral homeotic protein APETALA 1-2 | ||||
TrEMBL | A0A3N6SZE0 | 0.0 | A0A3N6SZE0_BRACR; Uncharacterized protein | ||||
STRING | Bo6g095760.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM792 | 25 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-164 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|