PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00116184001
Common NameGSBRNA2T00116184001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 601aa    MW: 68209.6 Da    PI: 7.3538
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00116184001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.81.2e-24112213199
                          EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                          f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF 
  GSBRNA2T00116184001 112 FTKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYKWKFKHIFRGQPRRHLLTTGWSTFVTSKKLVAGDTFVFL 199
                          89****************************9643..445569************************************************ PP

                          E-SSSEE..EEEEE-S CS
                   B3  84 ldgrsefelvvkvfrk 99 
                            + +++el+v+v+r+
  GSBRNA2T00116184001 200 --RGENGELRVGVRRA 213
                          ..449999******97 PP

2Auxin_resp115.64.3e-38238317183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a ha++t+s+F+v+Y+Pr+  s+F+++++k++ka+++k+svGmRfkm+fe++ds+err+sGtvvgv+d++p +W++SkWr+L+
  GSBRNA2T00116184001 238 ACHATQTRSMFTVYYKPRT--SQFIISLNKYLKAMNNKFSVGMRFKMRFEGDDSPERRFSGTVVGVQDCSP-HWKDSKWRCLE 317
                          6899**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.92E-39101241IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-42105227IPR015300DNA-binding pseudobarrel domain
CDDcd100177.78E-21110212No hitNo description
PfamPF023621.3E-22112213IPR003340B3 DNA binding domain
SMARTSM010191.2E-24112214IPR003340B3 DNA binding domain
PROSITE profilePS5086312.816112214IPR003340B3 DNA binding domain
PfamPF065074.6E-34238316IPR010525Auxin response factor
PfamPF023092.4E-7474530IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MTIGEEMYEE LWKLSAGPLV DVPQAEERVY YFPQGHMEQL EASTQQDLNT MKPLFDLPPK  60
ILCRVMNVRL QAEKETDEVY AQIMLMPEGT VDEPMSPDPS LPEPQRPKFH SFTKVLTASD  120
TSTHGGFSVL RKHATECLPP LDMTQQTPTQ ELVAEDVHGY KWKFKHIFRG QPRRHLLTTG  180
WSTFVTSKKL VAGDTFVFLR GENGELRVGV RRANRQQTNM PSSVISSHSM HLGVLATACH  240
ATQTRSMFTV YYKPRTSQFI ISLNKYLKAM NNKFSVGMRF KMRFEGDDSP ERRFSGTVVG  300
VQDCSPHWKD SKWRCLEVNW DEPASFTRPD KVSPWEMEPF AASENVPQSV NKRARHVNEV  360
SALDVGVPAS NFWSSALTQS HEFAQSCITS QRNPPQNSDW PVSPLNGQMV FPVEQKKPEI  420
TASCRLFGID LMSSSLPAHE EKTAPMRPIN ITKPTLDSNT DPKSEISKLS EEKKQEPAQA  480
SPKEVQSKQI NSSRSRTKVQ MQGVPVGRAV DLTLINGYVE LIDDLEKLFD IEGELKSRNQ  540
WPNSKWLYFF VCGCSEFCNM VKRIFIWSKE EVKKMTPGNP LRILLTEVDT TISKTENYSD  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-167234014355Auxin response factor 1
4ldw_A1e-167234014355Auxin response factor 1
4ldw_B1e-167234014355Auxin response factor 1
4ldx_A1e-167234014355Auxin response factor 1
4ldx_B1e-167234014355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.218811e-117root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00116184001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794730.0JN979473.1 Brassica rapa subsp. pekinensis auxin response factor 9-1 (ARF9-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013671492.10.0auxin response factor 9-like
RefseqXP_013715848.10.0auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A3N6QC710.0A0A3N6QC71_BRACR; Auxin response factor
STRINGBo1g037360.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]