PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00114310001

Common Name

GSBRNA2T00114310001, LOC106449568, NAC92.1

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NAC

Protein Properties

Length: 290aa MW: 33069.5 Da PI: 6.5139

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00114310001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	181	2.9e-56	20	146	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrFhPtdeel+++yLk+kv ++ +++ ++i evd++k+ePw+Lp+k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdk GSBRNA2T00114310001 20 LPPGFRFHPTDEELITHYLKQKVFNTFFSA-TAIGEVDLNKIEPWELPRKAKIGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDK 108 79***********************999.88***********99999********************************* PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 e+++ +++lvg+kktLvfykgrapkg++t+Wvmheyrle GSBRNA2T00114310001 109 EIFK-GKSLVGMKKTLVFYKGRAPKGVRTNWVMHEYRLE 146 .999***************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.41E-63	17	170	IPR003441	NAC domain
PROSITE profile	PS51005	59.855	20	170	IPR003441	NAC domain
Pfam	PF02365	1.2E-29	21	145	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 290 aa Download sequence Send to blast
MDYDASRIGE IVEDEEQIDL PPGFRFHPTD EELITHYLKQ KVFNTFFSAT AIGEVDLNKI 60 EPWELPRKAK IGEKEWYFFC VRDRKYPTGL RTNRATEAGY WKATGKDKEI FKGKSLVGMK 120 KTLVFYKGRA PKGVRTNWVM HEYRLEGIYS IQHLSQTAKN DWVICRVFHK RADGTKVDMS 180 HLMLLDSHVN RIEPVGLPSL MDSSQRDSFP GSSTHVTCFS DQETEDKRLI HLESKDGSGP 240 LFYPDPLFLT DNDSLMKLLL NSHETQFPGT GTDPSALAGM GESGCFWNF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-57	17	176	14	171	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-57	17	176	14	171	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-57	17	176	14	171	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-57	17	176	14	171	NO APICAL MERISTEM PROTEIN
3swm_A	1e-57	17	176	17	174	NAC domain-containing protein 19
3swm_B	1e-57	17	176	17	174	NAC domain-containing protein 19
3swm_C	1e-57	17	176	17	174	NAC domain-containing protein 19
3swm_D	1e-57	17	176	17	174	NAC domain-containing protein 19
3swp_A	1e-57	17	176	17	174	NAC domain-containing protein 19
3swp_B	1e-57	17	176	17	174	NAC domain-containing protein 19
3swp_C	1e-57	17	176	17	174	NAC domain-containing protein 19
3swp_D	1e-57	17	176	17	174	NAC domain-containing protein 19
4dul_A	1e-57	17	176	14	171	NAC domain-containing protein 19
4dul_B	1e-57	17	176	14	171	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.22009	1e-136	leaf

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Accumulates during leaf and flower aging (PubMed:20113437). Induced by EIN2 during leaf aging, but negatively regulated by miR164, which expression decreases gradually with aging through negative regulation by EIN2 (PubMed:19229035). In leaves, accumulates at the tips and margins and in leaves undergoing senescence. Present in floral organs of partly or fully opened flowers, but not in young flower buds. Expressed in pollen grains of mature anthers, but not in immature anthers. In petals of open flowers mostly observed in the tip region. In mature siliques, accumulates at the abscission zone, in the distal portion of the valve margins and the tip. In roots, detected in primary and lateral roots, but not in root tips. In seeds present in embryos and the micropylar endosperm (PubMed:20113437, PubMed:23340744). {ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:23340744}.
Uniprot	TISSUE SPECIFICITY: Mostly expressed in roots and flowers, and, to a lower extent, in shoots and leaves. Particularly expressed in old and senescing tissues. {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:23340744}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269\|PubMed:15295076, ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:21303842, ECO:0000269\|PubMed:23340744, ECO:0000269\|PubMed:23459204, ECO:0000269\|PubMed:9351240}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00114310001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19608714, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:20404534, ECO:0000269\|PubMed:21511905, ECO:0000269\|PubMed:22930749}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF738276	0.0	KF738276.1 Brassica napus NAC transcription factor 92 (NAC92.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001302993.1	0.0	NAC domain-containing protein 92-like
Refseq	XP_009139909.1	0.0	PREDICTED: NAC domain-containing protein 92
Swissprot	Q9FKA0	1e-173	NAC92_ARATH; NAC domain-containing protein 92
TrEMBL	A0A078CC51	0.0	A0A078CC51_BRANA; NAC transcription factor 92
TrEMBL	A0A397ZN78	0.0	A0A397ZN78_BRACM; Uncharacterized protein
TrEMBL	M4EA51	0.0	M4EA51_BRARP; Uncharacterized protein
STRING	Bra025658.1-P	0.0	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM400	28	174

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G39610.1	1e-175	NAC domain containing protein 6

Link Out ? help Back to Top
Entrez Gene	106449568

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Khan M,Rozhon W,Poppenberger B The role of hormones in the aging of plants - a mini-review. Gerontology, 2014. 60(1): p. 49-55 [PMID:24135638] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast. Plant J., 2015. 81(3): p. 377-87 [PMID:25440717] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Kim H, et al. Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453 [PMID:30065116]