PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00112416001 | ||||||||
Common Name | GSBRNA2T00112416001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 264aa MW: 29009.6 Da PI: 9.5807 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.1 | 2.3e-19 | 6 | 51 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde+l ++v ++G+++W+ I++ ++ gR++k+c++rw + GSBRNA2T00112416001 6 KGPWSPEEDEQLRKLVVKYGPRNWTVISKSIP-GRSGKSCRLRWCNQ 51 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 56.7 | 5.4e-18 | 60 | 102 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++eEde +++a++q+G++ W+tIar ++ gRt++ +k++w++ GSBRNA2T00112416001 60 PFSAEEDETIARAHAQFGNK-WATIARLLN-GRTDNAVKNHWNST 102 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 29.899 | 1 | 56 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.21E-31 | 3 | 99 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-17 | 5 | 54 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.2E-19 | 6 | 51 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.9E-25 | 7 | 58 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.34E-17 | 8 | 50 | No hit | No description |
SMART | SM00717 | 1.3E-14 | 57 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.77 | 58 | 107 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-22 | 59 | 106 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.84E-12 | 60 | 103 | No hit | No description |
Pfam | PF00249 | 5.6E-15 | 60 | 102 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:2000022 | Biological Process | regulation of jasmonic acid mediated signaling pathway | ||||
GO:2000031 | Biological Process | regulation of salicylic acid mediated signaling pathway | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 264 aa Download sequence Send to blast |
MADRIKGPWS PEEDEQLRKL VVKYGPRNWT VISKSIPGRS GKSCRLRWCN QLSPQVEHRP 60 FSAEEDETIA RAHAQFGNKW ATIARLLNGR TDNAVKNHWN STLKRKCGGF YASAEDQRPV 120 KRSVFKPVPR AGGVMLPLPI ETSTFCDDPA TSLSLSLPGA DVSEESNRSH ESTNNNTSRS 180 HNTNTMSLMQ FSGGFRGAIE EMGRSFGGNG GEFMAVVQEM IKAEVRSYMA EMQRNHSGGG 240 FVGGGFRDNG MIPMSQVGVG RIE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 3e-40 | 5 | 107 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 3e-40 | 5 | 107 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.3765 | 0.0 | bud| flower| microspore-derived embryo| root| seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00596 | DAP | Transfer from AT5G67300 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00112416001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC966737 | 0.0 | KC966737.1 Brassica napus MYB transcription factor 44 (MYB44.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009103434.1 | 0.0 | PREDICTED: transcription factor MYB44 | ||||
Swissprot | Q9FDW1 | 1e-145 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | A0A397YKI3 | 0.0 | A0A397YKI3_BRACM; Uncharacterized protein | ||||
STRING | Bra012149.1-P | 0.0 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM677 | 28 | 135 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 1e-133 | myb domain protein r1 |