PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00098998001
Common NameGSBRNA2T00098998001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 853aa    MW: 94095 Da    PI: 5.4052
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00098998001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.72.7e-29510560252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek++sl++l++yFs+++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rki+++
  GSBRNA2T00098998001 510 EKNVSLNVLQQYFSGSLKDAAKSLGVCPTTLKRICRQHGIMRWPSRKINKV 560
                          89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.427495580IPR003035RWP-RK domain
PfamPF020422.6E-27512560IPR003035RWP-RK domain
SuperFamilySSF542774.91E-22741836No hitNo description
Gene3DG3DSA:3.10.20.2401.4E-21748830No hitNo description
SMARTSM006666.0E-23750833IPR000270PB1 domain
PROSITE profilePS5174520.217750833IPR000270PB1 domain
CDDcd064072.15E-33751832No hitNo description
PfamPF005641.8E-16752832IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 853 aa     Download sequence    Send to blast
MENTSPDIPA EEMDGWVKNL ISEEDMFSSS SDLVNFESFA SWCNTPSASD ILFTQYGLTT  60
SQSTTPTPFG GFTALPAELS PSFHECSVPR SLSYSLDEKM LKALSLFMEF SGEGILAQFW  120
TPVKSGDHYM LSTCDQAYLL DSRLSGYREV SRKYTFSAET SQYSSPGLPG RVFISGVPEW  180
TSNVMYYKTA EYLRMKHALD NDVRGSIAIP VLQASGSSCC AVLELVTCRE KPNFDLEMDS  240
VCRALQAVNL QTSTIPRCQY VSSNQKEALS EIRDVLRAVC HAHRLPLALA WIPCSYSKGT  300
NNEMVKVYGK KSDENSLLCI EESACYVNDM DMECFVNACM EHYLSKGQGV AGKALVSNKP  360
SFSSDVKTFD ISEYPLVQHA RKFGLNAAVA TKLRSTFTGD SDYILEFFLP VNMKGSSEQQ  420
LLLDSLSGTM QRICRTLRTV SDEVGLWSGD RMLNLTQSTV TEGSFQTTLL DTDLNYTRSI  480
FSSDIAGSHG TLQQETSGAR RPERKKSSTE KNVSLNVLQQ YFSGSLKDAA KSLGVCPTTL  540
KRICRQHGIM RWPSRKINKV NRSLKKIQTV LDSVQGVEGG LKFDSATGEF IAVGSLVQEF  600
DTQKSLPCHH DDAFLKRQCD MDEDVSLELL KVKSHDGGKV KLEDSVETNE ARPAGSLMEP  660
WVSKQSGLNY SDDFDIGTRS ADVKKDKDLG VRRCLSSLAL AEPNPSISSS ISDSSNGSGA  720
VLVRSSSTSM EQDHNQTFRT HNSSSESGSL LTVKATYRDD TIRFKLDPYV VGCSQLYKEV  780
GKRFKLQEGA YQLKYLDDDE EWVMLVTDSD LQECLEILNG MRKHTVKFLV RDIPGAAMGS  840
SGGSNGYLGT GS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00098998001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104212.10.0PREDICTED: protein NLP9
SwissprotQ9M1B00.0NLP9_ARATH; Protein NLP9
TrEMBLM4CGP90.0M4CGP9_BRARP; Uncharacterized protein
STRINGBra003382.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22992768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]