PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00095993001 | ||||||||
Common Name | GSBRNA2T00095993001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 214aa MW: 24470.6 Da PI: 7.3822 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 181.5 | 2e-56 | 5 | 131 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrFhPtdeel+++yL++kv+++ ++ +++ +vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdk GSBRNA2T00095993001 5 LPPGFRFHPTDEELITHYLCRKVSDTGFTG-KAVVDVDLNKCEPWDLPAKASMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKTTGKDK 93 79*************************999.88***************999999************************************ PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 e+++ +g lvg+kktLvfykgrapkgek++Wvmheyrle GSBRNA2T00095993001 94 EIYR-SGVLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 131 ****.999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.07E-64 | 3 | 151 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.251 | 5 | 151 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.2E-29 | 6 | 130 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MEENLPPGFR FHPTDEELIT HYLCRKVSDT GFTGKAVVDV DLNKCEPWDL PAKASMGEKE 60 WYFFSLRDRK YPTGLRTNRA TEAGYWKTTG KDKEIYRSGV LVGMKKTLVF YKGRAPKGEK 120 SNWVMHEYRL ENKQPFTPAK EEWVVCRVFE KSTAIKKPQE QQPQSSFGSP CDANSSMANE 180 FEDIELPNLN SNSSTFDNIT SAAGLNMNMN MNIN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-59 | 4 | 157 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-59 | 4 | 157 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-59 | 4 | 157 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-59 | 4 | 157 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-59 | 4 | 157 | 19 | 174 | NAC domain-containing protein 19 |
3swm_B | 2e-59 | 4 | 157 | 19 | 174 | NAC domain-containing protein 19 |
3swm_C | 2e-59 | 4 | 157 | 19 | 174 | NAC domain-containing protein 19 |
3swm_D | 2e-59 | 4 | 157 | 19 | 174 | NAC domain-containing protein 19 |
3swp_A | 2e-59 | 4 | 157 | 19 | 174 | NAC domain-containing protein 19 |
3swp_B | 2e-59 | 4 | 157 | 19 | 174 | NAC domain-containing protein 19 |
3swp_C | 2e-59 | 4 | 157 | 19 | 174 | NAC domain-containing protein 19 |
3swp_D | 2e-59 | 4 | 157 | 19 | 174 | NAC domain-containing protein 19 |
4dul_A | 2e-59 | 4 | 157 | 16 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-59 | 4 | 157 | 16 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00095993001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB026658 | 2e-89 | AB026658.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MYF24. | |||
GenBank | CP002686 | 2e-89 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022576079.1 | 1e-155 | NAC domain-containing protein 100 | ||||
Swissprot | Q9FLJ2 | 1e-82 | NC100_ARATH; NAC domain-containing protein 100 | ||||
TrEMBL | A0A078JX15 | 1e-160 | A0A078JX15_BRANA; BnaCnng66480D protein (Fragment) | ||||
STRING | Bra022319.1-P | 1e-153 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5527 | 26 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18400.1 | 1e-137 | NAC domain containing protein 58 |
Publications ? help Back to Top | |||
---|---|---|---|
|