PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00094727001 | ||||||||
Common Name | GSBRNA2T00094727001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 319aa MW: 37327.2 Da PI: 9.6547 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 78.4 | 5e-25 | 83 | 133 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ienk+ rqvtfskRrng++KK ELSvLCda + +i+fs+tgkl y+s GSBRNA2T00094727001 83 KKIENKTSRQVTFSKRRNGLIKKTRELSVLCDAHIGLIVFSTTGKLTQYCS 133 68***********************************************96 PP | |||||||
2 | K-box | 56.4 | 1.3e-19 | 161 | 241 | 15 | 95 |
K-box 15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 l++e++ L++e+ +L+ +R + G dL s+ eL+ LeqqLe+s++k+R++K+ell +q+ +l +k+++l+++n+++ GSBRNA2T00094727001 161 DDLRHEIEILRRETCKLELRLRPYHGHDLASIPPHELEGLEQQLEHSVRKVRERKKELLQQQLGNLSRKKRMLEDDNNNMY 241 56889************************************************************************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.445 | 75 | 135 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.1E-38 | 75 | 134 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.58E-40 | 76 | 153 | No hit | No description |
SuperFamily | SSF55455 | 3.27E-30 | 76 | 159 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 77 | 131 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-27 | 77 | 97 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.5E-24 | 84 | 131 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-27 | 97 | 112 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-27 | 112 | 133 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.9E-18 | 159 | 244 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.142 | 160 | 250 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 319 aa Download sequence Send to blast |
MNSLQGYYGL KPTNRRASKE SRSLVDAVIS GFNQSSKPSK EVRCDKPMRD ANNLKLDFSL 60 RENRNSSSRR KRKEMGRGKI EIKKIENKTS RQVTFSKRRN GLIKKTRELS VLCDAHIGLI 120 VFSTTGKLTQ YCSEHSNMPQ LIDRYLTKEG LQLPDLNDDR DDLRHEIEIL RRETCKLELR 180 LRPYHGHDLA SIPPHELEGL EQQLEHSVRK VRERKKELLQ QQLGNLSRKK RMLEDDNNNM 240 YRWLHDEHRT GVEFQQAGIE TKPMEYQQFL EQVQYYNDHH QQQSSVLQLP TLPSEIDLSY 300 HLQLAQPNLQ NDPTTKVD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-16 | 75 | 145 | 1 | 69 | MEF2C |
5f28_B | 1e-16 | 75 | 145 | 1 | 69 | MEF2C |
5f28_C | 1e-16 | 75 | 145 | 1 | 69 | MEF2C |
5f28_D | 1e-16 | 75 | 145 | 1 | 69 | MEF2C |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 68 | 73 | RRKRKE |
2 | 208 | 216 | RKVRERKKE |
3 | 213 | 230 | RKKELLQQQLGNLSRKKR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.13305 | 0.0 | seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during seed development. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in buds, flowers and immature seeds, but not in roots, stems, leaves, seedlings or siliques valves. Expression in seed coat is confined to the endothelium layer. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00094727001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM449989 | 0.0 | HM449989.1 Brassica napus cultivar DH12075 MADS-box DNA-binding domain transcription factor (TT16.4) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009141444.1 | 0.0 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1 | ||||
Refseq | XP_009141450.1 | 0.0 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1 | ||||
Refseq | XP_013661058.1 | 0.0 | protein TRANSPARENT TESTA 16 isoform X1 | ||||
Swissprot | Q8RYD9 | 1e-130 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
TrEMBL | A0A078FV43 | 0.0 | A0A078FV43_BRANA; BnaA09g05410D protein | ||||
TrEMBL | A0A3P5YCZ0 | 0.0 | A0A3P5YCZ0_BRACM; Uncharacterized protein | ||||
STRING | Bra026507.1-P | 0.0 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6506 | 25 | 43 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 1e-118 | MIKC_MADS family protein |