PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00092816001

Common Name

GSBRNA2T00092816001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MIKC_MADS

Protein Properties

Length: 178aa MW: 21109.3 Da PI: 10.2958

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00092816001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	94.4	5e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fss++kl+e++s GSBRNA2T00092816001 9 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFIS 59 79***********************************************86 PP
2	K-box	75.9	1.1e-25	71	156	1	86

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	9.7E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.226	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.18E-39	2	80	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.7E-36	3	94	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-29	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.2E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-29	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	5.5E-15	82	156	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	12.275	84	177	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
MARGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELTVLCD ARVSIIMFSS SNKLHEFISP 60 NTTTKEIIDL YQTVSDVDVW SAHYERMQET KRKLLETNRK LRTQIKQRLG ECLDELDIQE 120 LRSLEEEMEN TFKLVRERKF KSLGNQIETT KKKVKTSSIF THFAFLSYYL SQYFRVM*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	2e-17	1	61	1	61	MEF2 CHIMERA
6byy_B	2e-17	1	61	1	61	MEF2 CHIMERA
6byy_C	2e-17	1	61	1	61	MEF2 CHIMERA
6byy_D	2e-17	1	61	1	61	MEF2 CHIMERA
6bz1_A	2e-17	1	61	1	61	MEF2 CHIMERA
6bz1_B	2e-17	1	61	1	61	MEF2 CHIMERA
6bz1_C	2e-17	1	61	1	61	MEF2 CHIMERA
6bz1_D	2e-17	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.7355	0.0	flower

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in petals and stamens.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269\|PubMed:18417639, ECO:0000269\|PubMed:8565821, ECO:0000269\|PubMed:9489703}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00092816001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269\|PubMed:11283333, ECO:0000269\|PubMed:19783648}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY313940	0.0	AY313940.1 Brassica napus APETALA3-1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009116122.1	1e-108	PREDICTED: floral homeotic protein APETALA 3
Refseq	XP_013602555.1	1e-108	PREDICTED: floral homeotic protein APETALA 3 isoform X1
Refseq	XP_013710394.1	1e-108	floral homeotic protein APETALA 3 isoform X1
Swissprot	P35632	1e-103	AP3_ARATH; Floral homeotic protein APETALA 3
TrEMBL	A0A078JQI6	1e-127	A0A078JQI6_BRANA; BnaAnng31650D protein
STRING	Bra007067.1-P	1e-107	(Brassica rapa)
STRING	Bo8g083600.1	1e-107	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5261	27	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G54340.1	1e-106	MIKC_MADS family protein

Publications ? help Back to Top
Furner I,Ellis L,Bakht S,Mirza B,Sheikh M CAUT lines: a novel resource for studies of cell autonomy in Arabidopsis. Plant J., 2008. 53(4): p. 645-60 [PMID:18269574] Jing D, et al. Two ancestral APETALA3 homologs from the basal angiosperm Magnolia wufengensis (Magnoliaceae) can affect flower development of Arabidopsis. Gene, 2014. 537(1): p. 100-7 [PMID:24334124] Zhang Y, et al. A cucumber DELLA homolog CsGAIP may inhibit staminate development through transcriptional repression of B class floral homeotic genes. PLoS ONE, 2014. 9(3): p. e91804 [PMID:24632777] Nakamura Y,Liu YC,Lin YC Floral glycerolipid profiles in homeotic mutants of Arabidopsis thaliana. Biochem. Biophys. Res. Commun., 2014. 450(4): p. 1272-5 [PMID:24984150] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Behrend A,Borchert T,Hohe A "The usual suspects"- analysis of transcriptome sequences reveals deviating B gene activity in C. vulgaris bud bloomers. BMC Plant Biol., 2015. 15: p. 8 [PMID:25604890] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Yunus IS, et al. Phosphatidic acid is a major phospholipid class in reproductive organs of Arabidopsis thaliana. Plant Signal Behav, 2015. 10(8): p. e1049790 [PMID:26179579] Sun JJ, et al. CsAP3: A Cucumber Homolog to Arabidopsis APETALA3 with Novel Characteristics. Front Plant Sci, 2016. 7: p. 1181 [PMID:27540391]