PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00092283001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 208aa MW: 23703.9 Da PI: 10.1461 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.9 | 1.7e-16 | 25 | 72 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd++l +++ +G g W+++a+ g++Rt+k+c++rw++yl GSBRNA2T00092283001 25 KGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYL 72 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.4 | 1.4e-17 | 78 | 121 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++l+++++++lG++ W++Ia++++ gRt++++k++w++ GSBRNA2T00092283001 78 RGNITAEEQLLIIQLHAKLGNR-WSKIAKYLP-GRTDNEIKNFWRT 121 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.901 | 20 | 72 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.16E-29 | 23 | 119 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.2E-12 | 24 | 74 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.2E-15 | 25 | 72 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.3E-22 | 26 | 79 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.01E-9 | 27 | 72 | No hit | No description |
PROSITE profile | PS51294 | 24.652 | 73 | 127 | IPR017930 | Myb domain |
SMART | SM00717 | 4.9E-16 | 77 | 125 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.5E-16 | 78 | 121 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.6E-24 | 80 | 126 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.14E-12 | 82 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0080086 | Biological Process | stamen filament development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MDKKKTGIRK ERIPAQKEEE GTVRKGPWTM EEDLILFNYI LNHGEGLWNS VAKASGLKRT 60 GKSCRLRWLN YLRPDVRRGN ITAEEQLLII QLHAKLGNRW SKIAKYLPGR TDNEIKNFWR 120 TKIQRHVKFS SSVNTINTRH CSGNSQSSVI TATDQGSSSK GFDMAESLIS PATTTTSFHM 180 MEQSNDSYWN VEDLWPLQLL NGDHQVI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-28 | 25 | 127 | 27 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed specifically in flowers. {ECO:0000269|PubMed:19325888}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor acting redundantly with MYB21 and MYB24 to control stamen filament elongation in the late developed flowers. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:19325888}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00324 | DAP | Transfer from AT3G01530 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00092283001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013585517.1 | 1e-154 | PREDICTED: transcription factor MYB57-like | ||||
Swissprot | Q9SSA1 | 1e-110 | MYB57_ARATH; Transcription factor MYB57 | ||||
TrEMBL | A0A0D3CND0 | 1e-154 | A0A0D3CND0_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6FKM9 | 1e-154 | A0A3P6FKM9_BRAOL; Uncharacterized protein (Fragment) | ||||
STRING | Bo5g155050.1 | 1e-154 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01530.1 | 1e-113 | myb domain protein 57 |