PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00091199001 | ||||||||
Common Name | GSBRNA2T00091199001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 82aa MW: 9427.92 Da PI: 9.928 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.5 | 4.8e-11 | 38 | 77 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 + +eE++l+ + +k+ G++ W++Ia +++ gRt++++ +w GSBRNA2T00091199001 38 MNQEEEDLICRMHKLVGNR-WELIAGRIP-GRTAEEVERFWV 77 679****************.*********.**********95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 3.0E-6 | 34 | 81 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.22E-7 | 37 | 80 | No hit | No description |
SuperFamily | SSF46689 | 2.18E-8 | 39 | 78 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.295 | 39 | 76 | IPR017877 | Myb-like domain |
Pfam | PF00249 | 1.0E-9 | 39 | 77 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-12 | 39 | 77 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
MDKHLRTKQA KTNPTVASSS TEGKLMKISS LEWEAVNMNQ EEEDLICRMH KLVGNRWELI 60 AGRIPGRTAE EVERFWVMKK K* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.25129 | 1e-58 | flower |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaf epidermal cells, stomate guard cells in leaves, cotyledons and hypocotyls, inflorescences, developing seeds and siliques. {ECO:0000269|PubMed:18305006}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269|PubMed:18305006}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00091199001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LC142708 | 2e-93 | LC142708.1 Brassica rapa subsp. nipposinica ETC1 mRNA for MYB-like transcription factor ETC1, partial cds, cultivar: Kyo-mizore. | |||
GenBank | LC142709 | 2e-93 | LC142709.1 Brassica rapa subsp. nipposinica ETC1 mRNA for MYB-like transcription factor ETC1, partial cds, cultivar: Kyo-nishiki. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009111414.1 | 8e-48 | PREDICTED: MYB-like transcription factor ETC3 isoform X1 | ||||
Refseq | XP_013660544.1 | 8e-48 | MYB-like transcription factor ETC3 isoform X1 | ||||
Swissprot | Q9M157 | 5e-27 | ETC3_ARATH; MYB-like transcription factor ETC3 | ||||
TrEMBL | A0A078ICB3 | 1e-52 | A0A078ICB3_BRANA; BnaA09g00230D protein | ||||
TrEMBL | A0A3P5XTV2 | 1e-52 | A0A3P5XTV2_BRACM; Uncharacterized protein | ||||
STRING | Bra037388.1-P | 3e-47 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01060.1 | 3e-38 | CAPRICE-like MYB3 |