PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00088744001 | ||||||||
Common Name | GSBRNA2T00088744001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 171aa MW: 19843.1 Da PI: 6.9461 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 36.4 | 1.1e-11 | 87 | 135 | 5 | 53 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 +++rr+ +NRe+ArrsR RK+ ++eL v L + N L+++l++ GSBRNA2T00088744001 87 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNDNNCLIDKLNSVL 135 79****************************************9999765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.4E-12 | 83 | 147 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.254 | 85 | 148 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 6.1E-10 | 87 | 144 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 3.5E-10 | 87 | 159 | No hit | No description |
SuperFamily | SSF57959 | 7.03E-12 | 87 | 136 | No hit | No description |
CDD | cd14702 | 2.87E-17 | 88 | 136 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 90 | 105 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MIPAEITGYF QYLSPEDLTM IPAEFNVINM PSSPTSSSSL NYLNDLINNN NYSSSSNGQD 60 LMLSNNSTSD EDYHHNHRQS IIILDERKQR RMLSNRESAR RSRMRKQRHL DELWSQVIRL 120 RNDNNCLIDK LNSVLETQDN VLKENSKLKE EASDLRRLVC DLKSNKYNSF * |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 99 | 106 | RRSRMRKQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00088744001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009152133.1 | 1e-120 | PREDICTED: basic leucine zipper 43-like | ||||
TrEMBL | A0A078IDD1 | 1e-119 | A0A078IDD1_BRANA; BnaA06g33560D protein | ||||
TrEMBL | A0A397Z7H9 | 1e-119 | A0A397Z7H9_BRACM; Uncharacterized protein | ||||
TrEMBL | M4E8N8 | 1e-119 | M4E8N8_BRARP; Uncharacterized protein | ||||
STRING | Bra025144.1-P | 1e-120 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2892 | 24 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G04038.1 | 8e-66 | basic leucine-zipper 48 |
Publications ? help Back to Top | |||
---|---|---|---|
|