PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00084755001

Common Name

GSBRNA2T00084755001, LOC106392406

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NAC

Protein Properties

Length: 278aa MW: 32124 Da PI: 7.66

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00084755001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	162	2.3e-50	16	140	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 pGfrFhPtdeel+ +yL++kve+k+++l e ik++diyk++PwdLp+ + ee+ewyfF+ r +ky+++ r+nr+t sg+Wkatg dk+ GSBRNA2T00084755001 16 LPGFRFHPTDEELLGYYLRRKVENKPIKL-ELIKQIDIYKFDPWDLPRVSSVEENEWYFFCMRGRKYKNSVRPNRVTGSGFWKATGIDKP 104 59*************************.99***********77777999******************************* PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 v+s + vglkk+Lv+y g+a kg+kt+W+mhe+rl GSBRNA2T00084755001 105 VYS-NLDCVGLKKSLVYYLGSAGKGSKTNWMMHEFRL 140 .9999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	53.661	15	164	IPR003441	NAC domain
SuperFamily	SSF101941	4.05E-56	16	163	IPR003441	NAC domain
Pfam	PF02365	9.2E-26	17	140	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 278 aa Download sequence Send to blast
MSGEGKDHEE EDEAKLPGFR FHPTDEELLG YYLRRKVENK PIKLELIKQI DIYKFDPWDL 60 PRVSSVEENE WYFFCMRGRK YKNSVRPNRV TGSGFWKATG IDKPVYSNLD CVGLKKSLVY 120 YLGSAGKGSK TNWMMHEFRL PSTAKSESPT QQAEVWTLCR IFKRVTHHRN PTTLQPNRRP 180 VITLTDSCSK TSSLDSDHTS HHVVESLSHK LHEPQRQPQT QNPYWNQLTT VGFNQPTYTC 240 HDNNLVNLWN INGEDFIGEP ASWDELRSVI DGNTNHL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-52	17	164	19	165	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-52	17	164	19	165	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-52	17	164	19	165	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-52	17	164	19	165	NO APICAL MERISTEM PROTEIN
3swm_A	2e-52	17	164	22	168	NAC domain-containing protein 19
3swm_B	2e-52	17	164	22	168	NAC domain-containing protein 19
3swm_C	2e-52	17	164	22	168	NAC domain-containing protein 19
3swm_D	2e-52	17	164	22	168	NAC domain-containing protein 19
3swp_A	2e-52	17	164	22	168	NAC domain-containing protein 19
3swp_B	2e-52	17	164	22	168	NAC domain-containing protein 19
3swp_C	2e-52	17	164	22	168	NAC domain-containing protein 19
3swp_D	2e-52	17	164	22	168	NAC domain-containing protein 19
4dul_A	2e-52	17	164	19	165	NAC domain-containing protein 19
4dul_B	2e-52	17	164	19	165	NAC domain-containing protein 19
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, root caps, cotyledons, tips and margin of young leaves, senescent regions of fully expanded leaves and floral tissues, including old sepals, petals, staments, mature anthers and pollen grains. Not detected in the abscission zone of open flowers, emerging lateral roots and root meristematic zones. {ECO:0000269\|PubMed:22345491}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269\|PubMed:22345491}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00084755001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269\|PubMed:22345491}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK352673	0.0	AK352673.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-06-P15.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013634618.1	0.0	PREDICTED: transcription factor JUNGBRUNNEN 1-like
Refseq	XP_013634619.1	0.0	PREDICTED: transcription factor JUNGBRUNNEN 1-like
Refseq	XP_013634620.1	0.0	PREDICTED: transcription factor JUNGBRUNNEN 1-like
Refseq	XP_013688681.1	0.0	transcription factor JUNGBRUNNEN 1
Refseq	XP_022569055.1	0.0	transcription factor JUNGBRUNNEN 1-like
Swissprot	Q9SK55	1e-167	NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBL	A0A078FK90	0.0	A0A078FK90_BRANA; BnaC04g48620D protein
TrEMBL	A0A0D3C5X3	0.0	A0A0D3C5X3_BRAOL; Uncharacterized protein
TrEMBL	A0A3P6CR22	0.0	A0A3P6CR22_BRAOL; Uncharacterized protein
STRING	Bo4g192870.1	0.0	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM306	28	200

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G43000.1	1e-158	NAC domain containing protein 42

Link Out ? help Back to Top
Entrez Gene	106392406

Publications ? help Back to Top
Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins. Plant Signal Behav, 2016. 11(6): p. e1181245 [PMID:27159137] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Shahnejat-Bushehri S, et al. Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato. Front Plant Sci, 2017. 8: p. 214 [PMID:28326087] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Ebrahimian-Motlagh S, et al. JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13. Front Plant Sci, 2017. 8: p. 2118 [PMID:29326734]