PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00083708001 | ||||||||
Common Name | GSBRNA2T00083708001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 169aa MW: 18616.6 Da PI: 4.7769 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 39.5 | 1.2e-12 | 29 | 87 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+ +NRe+ArrsR RK++ ++ L+ + +L++ N++ l ++++ k ++e+ GSBRNA2T00083708001 29 RKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSSDNRQILTSLTVTSELYMKIQAEN 87 57899*********************************998888877777777766665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 4.6E-10 | 25 | 70 | No hit | No description |
SMART | SM00338 | 1.4E-16 | 25 | 89 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.117 | 27 | 73 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.5E-10 | 29 | 86 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.67E-12 | 29 | 80 | No hit | No description |
CDD | cd14702 | 2.65E-21 | 30 | 81 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 32 | 47 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MASSSSTYRS SSSSDGGNPS DSAVTVDERK RKRMLSNRES ARRSRMRKQK HVDDLTAQIN 60 QLSSDNRQIL TSLTVTSELY MKIQAENSVF TAQMAELSTR LESLNEIVDL VTTTNGGVDQ 120 IDGCGFDDRT AGINCDGYYD DMMMSGVNHW GGSVYTNQPI MANDINMY* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 28 | 49 | RKRKRMLSNRESARRSRMRKQK |
2 | 41 | 48 | RRSRMRKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.4397 | 0.0 | bud| leaf| microspore-derived embryo| root| seed| vegetative meristem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot meristem during vegetative to reproductive phase transition. {ECO:0000269|PubMed:22319055}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to specific DNA sequences in target gene promoters. BZIP2-BZIP63-KIN10 complex binds to the ETFQO promoter to up-regulate its transcription (PubMed:29348240). {ECO:0000250|UniProtKB:O65683, ECO:0000269|PubMed:29348240}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00267 | DAP | Transfer from AT2G18160 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00083708001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232550 | 0.0 | AC232550.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH011J16, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018433382.1 | 1e-110 | PREDICTED: bZIP transcription factor 2 | ||||
Swissprot | Q9SI15 | 3e-93 | BZIP2_ARATH; bZIP transcription factor 2 | ||||
TrEMBL | A0A078I885 | 1e-120 | A0A078I885_BRANA; BnaA07g01890D protein | ||||
STRING | Bo7g011520.1 | 1e-113 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM501 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G18160.1 | 1e-89 | basic leucine-zipper 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|