PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00080490001 | ||||||||
Common Name | GSBRNA2T00080490001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | CPP | ||||||||
Protein Properties | Length: 143aa MW: 15871.8 Da PI: 6.4916 | ||||||||
Description | CPP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCR | 35.6 | 1.8e-11 | 63 | 97 | 1 | 35 |
TCR 1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCed 35 k++kgC+Ckks kkYCeCf+a++ Cse+ C++ GSBRNA2T00080490001 63 KHNKGCHCKKSGYFKKYCECFQANNLCSENWDCKN 97 589**************************999987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51634 | 20.285 | 1 | 103 | IPR005172 | CRC domain |
SMART | SM01114 | 1.3E-8 | 63 | 101 | IPR033467 | Tesmin/TSO1-like CXC domain |
Pfam | PF03638 | 1.2E-7 | 66 | 97 | IPR005172 | CRC domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MYLIGFVSGT YCDGWNCVNC FNKVDNEPAR RDAAETTMER NPNAFSPKKL LAEEIGKVVL 60 LGKHNKGCHC KKSGYFKKYC ECFQANNLCS ENWDCKNFEG SEERQALFHG EHANNIAYLH 120 QEANAAIHEA VGSSGFSLSP EP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5fd3_A | 2e-13 | 1 | 109 | 24 | 132 | Protein lin-54 homolog |
5fd3_B | 2e-13 | 1 | 109 | 24 | 132 | Protein lin-54 homolog |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00080490001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009129079.1 | 1e-70 | PREDICTED: protein tesmin/TSO1-like CXC 5 | ||||
Swissprot | Q9SZD1 | 1e-67 | TCX5_ARATH; Protein tesmin/TSO1-like CXC 5 | ||||
TrEMBL | A0A078I642 | 1e-102 | A0A078I642_BRANA; BnaA04g10170D protein | ||||
TrEMBL | M4E9Y3 | 1e-102 | M4E9Y3_BRARP; Uncharacterized protein | ||||
STRING | Bra025590.1-P | 1e-102 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1783 | 28 | 84 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G29000.1 | 5e-70 | Tesmin/TSO1-like CXC domain-containing protein |
Publications ? help Back to Top | |||
---|---|---|---|
|