PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00079177001 | ||||||||
Common Name | GSBRNA2T00079177001, LOC106427708 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 298aa MW: 33351.8 Da PI: 6.5266 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29.2 | 2.1e-09 | 28 | 73 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46 +WT eE +++ +a + + ++ +W+++a++++ g+t +++ ++ GSBRNA2T00079177001 28 KWTHEENKKFENALAFYDKDtpdRWNKVAAMLP-GKTVGDVIKQYRE 73 8********************************.******9999986 PP | |||||||
2 | Myb_DNA-binding | 48.6 | 1.9e-15 | 140 | 184 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky GSBRNA2T00079177001 140 PWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 184 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.4E-5 | 23 | 74 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 9.2 | 24 | 77 | IPR017884 | SANT domain |
SMART | SM00717 | 3.5E-10 | 25 | 77 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.05E-11 | 27 | 79 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.00E-7 | 28 | 74 | No hit | No description |
Pfam | PF00249 | 6.2E-8 | 28 | 73 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 21.845 | 133 | 189 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.66E-17 | 135 | 188 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.5E-18 | 136 | 188 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 8.7E-14 | 137 | 187 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.7E-13 | 137 | 184 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.31E-11 | 140 | 185 | No hit | No description |
Pfam | PF00249 | 7.7E-13 | 140 | 184 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 298 aa Download sequence Send to blast |
MNRRIEVLSS ATYLDTSNWL FQENRGTKWT HEENKKFENA LAFYDKDTPD RWNKVAAMLP 60 GKTVGDVIKQ YRELEEDLSD IEAGRIPIPG YASDSFTLDW GGYDAGNNGF NMNGYYFPAS 120 GGKRGSAARA AEHERKKGVP WTEEEHRQFL MGLKKYGKGD WRNIARNFVT TRTPTQVASH 180 AQKYFIRQVN GGKDKRRSSI HDITTVNISD SPDAAAADSA TANAPCSPPS VGGSQREASD 240 HWEGQTTYVE TAAAFYNQNV FQETLLGMSS TPYMAKLQEQ SFLNASQFES YNAYLQM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 2e-16 | 26 | 91 | 8 | 73 | RADIALIS |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.6866 | 1e-173 | root| seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00079177001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK118135 | 0.0 | AK118135.1 Arabidopsis thaliana At2g38090 mRNA for putative MYB family transcription factor, complete cds, clone: RAFL19-43-J04. | |||
GenBank | AY519529 | 0.0 | AY519529.1 Arabidopsis thaliana MYB transcription factor (At2g38090) mRNA, complete cds. | |||
GenBank | BT006122 | 0.0 | BT006122.1 Arabidopsis thaliana clone U50930 putative MYB family transcription factor (At2g38090) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013723880.1 | 0.0 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 5e-94 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A078FJ69 | 0.0 | A0A078FJ69_BRANA; BnaC03g21050D protein | ||||
TrEMBL | A0A3P6AZ91 | 0.0 | A0A3P6AZ91_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g032160.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1228 | 27 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38090.1 | 1e-172 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106427708 |
Publications ? help Back to Top | |||
---|---|---|---|
|