PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00075572001 | ||||||||
Common Name | GSBRNA2T00075572001, LOC106380116 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 229aa MW: 26711.8 Da PI: 8.984 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.8 | 1.6e-29 | 19 | 69 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRr+g++KKA+ELSvLCda+va i+fs++gklyey+s GSBRNA2T00075572001 19 KRIENLTSRQVTFSKRRKGLMKKAHELSVLCDAQVAAIVFSQKGKLYEYAS 69 79***********************************************86 PP | |||||||
2 | K-box | 51.8 | 3.6e-18 | 93 | 186 | 9 | 99 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk...ekelqeenkaLr 95 ++e++ + l+ e++ + + ie Lqr R+l+GedL+++s++eL+++ q+eksl+ +Rs+K +l +++ +l+ ++el +e ++L+ GSBRNA2T00075572001 93 QKEQQVQDLKDEITIMVNSIELLQRHCRRLMGEDLDTCSVEELKEITIQIEKSLTIVRSRKAKLNEDEVGKLKAEiagKRELLNERTRLH 182 78999******************************************************************9976333577778888888 PP K-box 96 kkle 99 +++e GSBRNA2T00075572001 183 EMFE 186 7776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.964 | 11 | 71 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.4E-40 | 11 | 70 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.45E-31 | 13 | 82 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.72E-39 | 13 | 78 | No hit | No description |
PRINTS | PR00404 | 1.1E-29 | 13 | 33 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.7E-26 | 20 | 67 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-29 | 33 | 48 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-29 | 48 | 69 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.3E-18 | 94 | 185 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.386 | 98 | 191 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MDSPTNHGRR MVKGKIEIKR IENLTSRQVT FSKRRKGLMK KAHELSVLCD AQVAAIVFSQ 60 KGKLYEYASS DMKKMIERCE LHRREYFHEE RLQKEQQVQD LKDEITIMVN SIELLQRHCR 120 RLMGEDLDTC SVEELKEITI QIEKSLTIVR SRKAKLNEDE VGKLKAEIAG KRELLNERTR 180 LHEMFEEKPL WMQSRNLESE KNASSSGCEN IHISNVETDL FIGLPRRV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 6e-19 | 11 | 76 | 1 | 66 | MEF2C |
5f28_B | 6e-19 | 11 | 76 | 1 | 66 | MEF2C |
5f28_C | 6e-19 | 11 | 76 | 1 | 66 | MEF2C |
5f28_D | 6e-19 | 11 | 76 | 1 | 66 | MEF2C |
6byy_A | 5e-19 | 11 | 76 | 1 | 66 | MEF2 CHIMERA |
6byy_B | 5e-19 | 11 | 76 | 1 | 66 | MEF2 CHIMERA |
6byy_C | 5e-19 | 11 | 76 | 1 | 66 | MEF2 CHIMERA |
6byy_D | 5e-19 | 11 | 76 | 1 | 66 | MEF2 CHIMERA |
6bz1_A | 6e-19 | 11 | 76 | 1 | 66 | MEF2 CHIMERA |
6bz1_B | 6e-19 | 11 | 76 | 1 | 66 | MEF2 CHIMERA |
6bz1_C | 6e-19 | 11 | 76 | 1 | 66 | MEF2 CHIMERA |
6bz1_D | 6e-19 | 11 | 76 | 1 | 66 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00075572001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232542 | 1e-114 | AC232542.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH005L20, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009130170.1 | 1e-167 | PREDICTED: MADS-box protein AGL71-like | ||||
Refseq | XP_013675386.1 | 1e-167 | MADS-box protein AGL71 | ||||
Swissprot | Q9LT93 | 2e-71 | AGL71_ARATH; MADS-box protein AGL71 | ||||
TrEMBL | A0A078HZW3 | 1e-165 | A0A078HZW3_BRANA; BnaAnng06990D protein | ||||
TrEMBL | A0A3P6B971 | 1e-165 | A0A3P6B971_BRACM; Uncharacterized protein | ||||
STRING | Bo2g161560.1 | 1e-153 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM8805 | 12 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 9e-77 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106380116 |
Publications ? help Back to Top | |||
---|---|---|---|
|