PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00073050001 | ||||||||
Common Name | GSBRNA2T00073050001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 122aa MW: 14027.8 Da PI: 9.5287 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 28.5 | 2.7e-09 | 77 | 110 | 21 | 54 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 k +yp++ ++ LA+ +gL+++q+ +WF N+R + GSBRNA2T00073050001 77 KWPYPTEGDKIALADATGLDQKQINNWFINQRKR 110 569*****************************88 PP | |||||||
2 | ELK | 27.1 | 9.4e-10 | 31 | 52 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 +LK++LlrK+++ ++sLk EFs GSBRNA2T00073050001 31 DLKDRLLRKFGSGISSLKLEFS 52 69*******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 2.5E-4 | 31 | 52 | IPR005539 | ELK domain |
Pfam | PF03789 | 5.3E-6 | 31 | 52 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 9.202 | 31 | 51 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.179 | 51 | 114 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.99E-19 | 52 | 118 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 4.0E-12 | 53 | 118 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-27 | 56 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.33E-10 | 60 | 115 | No hit | No description |
Pfam | PF05920 | 5.8E-18 | 71 | 110 | IPR008422 | Homeobox KN domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MFKDGAVSSD EELSGGDEIS QDGKQICEDR DLKDRLLRKF GSGISSLKLE FSKKKKKGKL 60 PREARQALLD WWSVHYKWPY PTEGDKIALA DATGLDQKQI NNWFINQRKR HWNQSENMPF 120 A* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First detected in torpedo stage embryos at the boundaries between the presumptive SAM and the cotyledons. Later expressed between the cotyledons and the meristem, and between the cotyledons. In seedlings, localised in stipules and at the boundaries between the SAM and the emerging primordia. Expressed at the site of lateral roots. {ECO:0000269|PubMed:16798887}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed predominantly in shoot apices of seedlings, and, to a lower extent, in rosette leaves. {ECO:0000269|PubMed:11311158}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00073050001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009110101.1 | 2e-82 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 7e-68 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A078HVR4 | 1e-83 | A0A078HVR4_BRANA; BnaA08g20510D protein | ||||
TrEMBL | A0A397YFC1 | 5e-81 | A0A397YFC1_BRACM; Uncharacterized protein | ||||
TrEMBL | M4DIM1 | 5e-81 | M4DIM1_BRARP; Uncharacterized protein | ||||
STRING | Bra016348.1-P | 9e-82 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM835 | 27 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 3e-62 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|