PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00066725001 | ||||||||
Common Name | GSBRNA2T00066725001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 205aa MW: 23334 Da PI: 9.9856 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.7 | 1.5e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien++ rqvtfskRr g++KKA+ELSvLCda+va iifs++g+ly+++s GSBRNA2T00066725001 9 KKIENTTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAIIFSQKGRLYDFAS 59 68***********************************************86 PP | |||||||
2 | K-box | 60.2 | 8.6e-21 | 84 | 171 | 10 | 97 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +e+ + l++e+ + ++ie+L+ + +l+G++L +slkeLq++ +q+eksl +Rs+K +l+ +++e+l+ k +el++e +L+ + GSBRNA2T00066725001 84 TEQYVQGLKKEMVTMVEKIEMLEVHNQKLMGKSLAFCSLKELQEIATQIEKSLHIVRSRKAKLYEDEVEKLKAKGRELKDERVRLSGR 171 6788899****************999*******************************************************9998765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.1E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.511 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.09E-31 | 3 | 88 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.51E-40 | 3 | 74 | No hit | No description |
PRINTS | PR00404 | 2.5E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.4E-19 | 88 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.487 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 205 aa Download sequence Send to blast |
MVRGKIQIKK IENTTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAIIFSQ KGRLYDFASS 60 DIQKTIKRYA EYKGEYFVAE SHPTEQYVQG LKKEMVTMVE KIEMLEVHNQ KLMGKSLAFC 120 SLKELQEIAT QIEKSLHIVR SRKAKLYEDE VEKLKAKGRE LKDERVRLSG RVGEEPSGMP 180 MPSGSKEKED VETDLSIGFP KTRS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-21 | 1 | 93 | 1 | 90 | MEF2C |
5f28_B | 2e-21 | 1 | 93 | 1 | 90 | MEF2C |
5f28_C | 2e-21 | 1 | 93 | 1 | 90 | MEF2C |
5f28_D | 2e-21 | 1 | 93 | 1 | 90 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00066725001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009132583.1 | 1e-143 | PREDICTED: MADS-box protein AGL72-like | ||||
Refseq | XP_009132584.1 | 1e-143 | PREDICTED: MADS-box protein AGL72-like | ||||
Refseq | XP_013640563.1 | 1e-143 | MADS-box protein AGL72-like | ||||
Refseq | XP_022571027.1 | 1e-143 | MADS-box protein AGL72-like | ||||
Swissprot | Q9FLH5 | 1e-116 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | A0A078HMP5 | 1e-146 | A0A078HMP5_BRANA; BnaA03g12980D protein | ||||
STRING | Bra029155.1-P | 1e-143 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 1e-122 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|