| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | B3 | 76.9 | 2.3e-24 | 156 | 257 | 1 | 99 |
EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
B3 1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85
f+k+lt sd++++g +++p++ ae++ +k++ s++l +d++g +W++++iyr++++r++lt+GW++Fv+ ++L +gD v+F
GSBRNA2T00064571001 156 FCKTLTASDTSTHGGFSVPRRAAEDCfppldYSKPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSGFVNKKKLVSGDAVLFL-- 243
99****************************945566778*************************************************.. PP
SSSEE..EEEEE-S CS
B3 86 grsefelvvkvfrk 99
+ ++++l+++v+r+
GSBRNA2T00064571001 244 RGDDGKLRLGVRRA 257
3489999****997 PP
|
| 2 | Auxin_resp | 114.2 | 1.2e-37 | 282 | 363 | 1 | 82 |
Auxin_resp 1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82
+aha+st+s+F+++YnP+as+s+F+v+++k++k ++ ++++GmRfk ++e+ed+serr G+++g+sdldp+rWp+SkWr+L
GSBRNA2T00064571001 282 VAHAISTNSAFNIYYNPKASWSNFIVPAKKFLKIVDYPFCIGMRFKARVESEDASERRSLGIITGISDLDPIRWPGSKWRCL 363
79*******************************************************************************9 PP
|
| Publications
? help Back to Top |
- Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
Mol. Gen. Mikrobiol. Virusol., 2013.
[PMID:24003511] - Chalhoub B, et al.
Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
Science, 2014. 345(6199): p. 950-3
[PMID:25146293] - Thoma R,Chandler JW
Polarity in the early floral meristem of Arabidopsis.
Plant Signal Behav, 2015. 10(4): p. e992733
[PMID:25806573] - Lora J,Hormaza JI,Herrero M
Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT).
New Phytol., 2015. 208(2): p. 584-95
[PMID:25991552] - Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
[PMID:26108442] - Cabrera J, et al.
Differentially expressed small RNAs in Arabidopsis galls formed by Meloidogyne javanica: a functional role for miR390 and its TAS3-derived tasiRNAs.
New Phytol., 2016. 209(4): p. 1625-40
[PMID:26542733] - Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
Plant Cell, 2015. 27(12): p. 3321-35
[PMID:26589551] - Yamaguchi N,Wu MF,Winter CM,Wagner D
LEAFY and Polar Auxin Transport Coordinately Regulate Arabidopsis Flower Development.
Plants (Basel), 2014. 3(2): p. 251-65
[PMID:27135503] - Matsumura Y, et al.
A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
Biol Open, 2016. 5(7): p. 942-54
[PMID:27334696] - Simonini S, et al.
A noncanonical auxin-sensing mechanism is required for organ morphogenesis in Arabidopsis.
Genes Dev., 2016. 30(20): p. 2286-2296
[PMID:27898393] - Pfannebecker KC,Lange M,Rupp O,Becker A
An Evolutionary Framework for Carpel Developmental Control Genes.
Mol. Biol. Evol., 2017. 34(2): p. 330-348
[PMID:28049761] - Wójcikowska B,Gaj MD
Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
Plant Cell Rep., 2017. 36(6): p. 843-858
[PMID:28255787] - Su Z, et al.
The THO Complex Non-Cell-Autonomously Represses Female Germline Specification through the TAS3-ARF3 Module.
Curr. Biol., 2017. 27(11): p. 1597-1609.e2
[PMID:28552357] - Simonini S,Bencivenga S,Trick M,Østergaard L
Auxin-Induced Modulation of ETTIN Activity Orchestrates Gene Expression in Arabidopsis.
Plant Cell, 2017. 29(8): p. 1864-1882
[PMID:28804059] - Guan C, et al.
Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
Curr. Biol., 2017. 27(19): p. 2940-2950.e4
[PMID:28943086] - Simonini S, et al.
Corrigendum: A noncanonical auxin-sensing mechanism is required for organ morphogenesis in Arabidopsis.
Genes Dev., 2017. 31(17): p. 1821
[PMID:28982764] - Zhang K, et al.
AUXIN RESPONSE FACTOR3 Regulates Floral Meristem Determinacy by Repressing Cytokinin Biosynthesis and Signaling.
Plant Cell, 2018. 30(2): p. 324-346
[PMID:29371438] - Vial-Pradel S, et al.
Arabidopsis Zinc-Finger-Like Protein ASYMMETRIC LEAVES2 (AS2) and Two Nucleolar Proteins Maintain Gene Body DNA Methylation in the Leaf Polarity Gene ETTIN (ARF3).
Plant Cell Physiol., 2018. 59(7): p. 1385-1397
[PMID:29415182] - Simonini S,Stephenson P,Østergaard L
A molecular framework controlling style morphology in Brassicaceae.
Development, 2018.
[PMID:29440299] - Andres-Robin A, et al.
Evidence for the Regulation of Gynoecium Morphogenesis by ETTIN via Cell Wall Dynamics.
Plant Physiol., 2018. 178(3): p. 1222-1232
[PMID:30237208] - Hablak SG
Features inheritance of root system Arabidopsis thaliana (L.) Heynh. the interaction of genes CTR1 AND ALF3, NPH4 and IAR2.
Tsitol. Genet., 2019.
[PMID:30484609]
|
